KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005517
Entry
103005517         CDS       T03086                                 

Gene name
RXRA
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03320  PPAR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04659  Th17 cell differentiation
bacu04919  Thyroid hormone signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04932  Non-alcoholic fatty liver disease
bacu04976  Bile secretion
bacu05160  Hepatitis C
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05216  Thyroid cancer
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103005517 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103005517 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103005517 (RXRA)
   03320 PPAR signaling pathway
    103005517 (RXRA)
   04919 Thyroid hormone signaling pathway
    103005517 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    103005517 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    103005517 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005517 (RXRA)
   05202 Transcriptional misregulation in cancer
    103005517 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    103005517 (RXRA)
   05216 Thyroid cancer
    103005517 (RXRA)
   05222 Small cell lung cancer
    103005517 (RXRA)
   05223 Non-small cell lung cancer
    103005517 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103005517 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103005517 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103005517 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103005517 (RXRA)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103005517 (RXRA)
Nuclear receptors [BR:bacu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103005517 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 103005517
NCBI-ProteinID: XP_007194490
UniProt: A0A384B4D1
LinkDB
Position
Un
AA seq 439 aa
MAAPSLHPSLGPGIGSSLSSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRAENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANVGPNPSSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKAELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccctccctggggcccggcatcggctcctcgctcagctcc
ccgggacagctgcactcgcccatcagcaccctgagctcccccatcaacggcatgggcccg
cccttctcggtcatcagctcccccatgggcccccactccatgtccgtgcccaccacaccc
accttgggcttcggcaccggcagcccccagctcaactcgcccatgaaccccgtcagcagc
agcgaggacatcaagcccccgctgggcctcaacggtgtcctcaaagtcccggcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgctatctgcggggaccgctcctca
ggcaagcactacggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacctgccgggacaacaaggactgcctgattgacaagcggcag
cggaaccggtgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgcgaa
gctgtgcaggaggagcggcagcggggcaaagaccgggctgagaacgaggtggagtccacg
agcagcgccaacgaggacatgccagtggagaagatcctggaggccgagctggccgtcgaa
cccaagaccgagacgtacgtggaggcaaatgtggggccgaaccccagctcgcccaatgac
cctgtcaccaacatctgccaagcggccgacaagcagctcttcaccctggtggagtgggcc
aagcggatcccgcacttctctgagctgcccctggacgaccaggtcatcctgctgcgggca
ggctggaacgagctgctcatcgcctccttctcccaccgctccatagccgtgaaggacggc
atcctcctggccaccgggctgcacgtccaccgcaatagcgcccacagcgcgggggtgggc
gccatctttgacagggtgctgacggagctggtgtccaagatgcgggacatgcagatggac
aaggcggagctgggctgcctgcgcgccatcgtcctcttcaaccccgactccaaggggctc
tcaaacccggccgaggtggaagcgcttcgcgagaaggtctacgcgtccctggaggcgtac
tgcaaacacaagtaccccgagcagccaggaaggtttgccaagctgctgcttcgtctgccg
gccctgcgctccatcggcctcaagtgcctggaacacctcttcttcttcaaactcatcggg
gacacgcccatcgacaccttcctcatggagatgctggaagccccgcaccaaatgacttag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006710
Entry
103006710         CDS       T03086                                 

Gene name
RXRB
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03320  PPAR signaling pathway
bacu04659  Th17 cell differentiation
bacu04919  Thyroid hormone signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05216  Thyroid cancer
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103006710 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103006710 (RXRB)
   03320 PPAR signaling pathway
    103006710 (RXRB)
   04919 Thyroid hormone signaling pathway
    103006710 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    103006710 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006710 (RXRB)
   05202 Transcriptional misregulation in cancer
    103006710 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    103006710 (RXRB)
   05216 Thyroid cancer
    103006710 (RXRB)
   05222 Small cell lung cancer
    103006710 (RXRB)
   05223 Non-small cell lung cancer
    103006710 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103006710 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103006710 (RXRB)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103006710 (RXRB)
Nuclear receptors [BR:bacu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103006710 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 103006710
NCBI-ProteinID: XP_007186969
UniProt: A0A384AIB7
LinkDB
Position
Un
AA seq 537 aa
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAVAAGEQQT
PEPEPGEAGRDGMGDSGLDSRSPDSSSPNPLPQGAAPPSPPGPPLPPSAAASLGGSGAPP
PPPMPPPPLGSPFPVISSSWGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVK
PPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYS
CRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMP
VDRILEAELAVEQKSDQGVEGPGGTAGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHF
SSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRS
LSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCK
QKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgtcttgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcgtcccggtggcggcggcgacgg
ccctggctggatcccgcagcagcagcggcggcggcggtggcagccggagaacaacaaacc
ccggagccggagccgggggaggctggacgggacgggatgggcgacagcgggctggactcc
cgaagcccagacagttcctctccaaatccccttccccagggggccgctcccccttctcct
ccggggccacccttacccccttcagcagctgcatcccttggaggctctggggctccaccc
ccacccccgatgccacccccgccactgggctcccccttcccggtcatcagctcttcctgg
gggtcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccc
cagattaactcaacagtgtcgctccctgggggtgggtctggcccccctgaagatgtgaag
ccaccagtcttaggggtccggggcctgcactgtccaccccctccaggtggccctggggct
ggcaaacgtctatgtgcaatctgcggggaccgaagctcaggcaaacactacggggtttac
agctgtgagggctgcaaaggcttcttcaagcgcaccatccgtaaggacctgacctactcg
tgccgggacaacaaggactgcacggtggacaagcgccagcggaaccgctgtcagtactgc
cgctatcagaagtgcctggccaccggcatgaagagggaggcggtacaggaggagcgtcag
cggggaaaggacaaggatggggatggggagggggctgggggagcccccgaggagatgccc
gtggacaggatcctggaggcagagcttgctgtggagcagaagagtgaccagggcgttgag
ggtcctgggggaaccgcgggtagcggcagcagcccaaatgaccctgtgactaacatctgc
caggcagctgacaaacagctcttcacacttgttgagtgggcaaagaggatcccacacttt
tcctccttgcctctggatgaccaggtcatactgctacgggcaggctggaacgagctcctc
attgcctccttctctcaccgatccatcgatgtccgagacggcatcctcctcgccacaggt
cttcacgtgcaccgcaactcagcccattctgcaggcgtgggagccatctttgatcggtcc
ctctccagggtgctgacagagctagtgtccaaaatgcgtgacatgaggatggacaagaca
gaacttggctgcctgagggcaatcattctgttcaatccagatgccaagggcctctccaac
cccagcgaggtagaggtcctgcgggagaaagtgtacgcgtccctggagacctattgcaaa
cagaagtaccctgagcagcagggccggtttgccaagctgctcttgcgtcttcctgctctc
aggtccataggccttaagtgtctagagcatctgtttttcttcaagctcattggtgacacc
cccatcgacactttcctcatggagatgcttgaggctccccaccagctggcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017600
Entry
103017600         CDS       T03086                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03320  PPAR signaling pathway
bacu04659  Th17 cell differentiation
bacu04919  Thyroid hormone signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05216  Thyroid cancer
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103017600 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103017600 (RXRG)
   03320 PPAR signaling pathway
    103017600 (RXRG)
   04919 Thyroid hormone signaling pathway
    103017600 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    103017600 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017600 (RXRG)
   05202 Transcriptional misregulation in cancer
    103017600 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    103017600 (RXRG)
   05216 Thyroid cancer
    103017600 (RXRG)
   05222 Small cell lung cancer
    103017600 (RXRG)
   05223 Non-small cell lung cancer
    103017600 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103017600 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103017600 (RXRG)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    103017600 (RXRG)
Nuclear receptors [BR:bacu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   103017600 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 103017600
NCBI-ProteinID: XP_007191136
UniProt: A0A384AUR1
LinkDB
Position
Un
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHASYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatggaaattattctcacttcatgaagtttcccacaggctttggaggttcccccggc
cactctggctccacgtccatgagcccgtcggcagccttgtccacagggaagcccatggac
agccacgccagctacactgacaccccagtgagtgccccacggactctgagtgcagtgggg
acccccctcaatgccctgggctctccatatcgagtcatcacttctgccatgggcccaccc
tcaggagctctggcagcccctccaggaatcaatttggttgccccgcccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaaacccttaccagggcttcctggc
attggaaacatgaactacccatccactagccctggatctctggttaaacacatctgtgcc
atctgtggggacagatcctcaggaaagcactacggtgtgtacagttgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatctacacgtgtcgggataataaagac
tgcctcattgacaagcgtcagcgcaaccgctgccaatactgtcgctatcagaagtgcctt
gtcatgggcatgaagagggaagctgtgcaagaagaaaggcagagaagccgggagcgggct
gagagtgaggcagaatgtgccagtagtggccatgaagatatgcccgtggagaggattctg
gaggctgaacttgctgttgaaccaaagacagaatcctacggtgacatgaacatggagaat
tcgacaaatgaccccgtcaccaacatatgccatgctgctgacaagcagctctttactctc
gttgaatgggccaagcgtattccccacttctctgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaatgaattgctgatcgcctccttttcccaccgctcggtttct
gtgcaggatggcatccttctggccacgggtttacacgtccaccggagcagtgcccacagt
gctggggttggctccatctttgacagagttctgactgagctggtctccaaaatgaaagac
atgcagatggataagtcggagctggggtgcctacgagccatcgtgctatttaacccagat
gccaagggtctgtccaacccctctgaggtggagactctgcgagagaaggtttatgccacc
ctcgaggcctacaccaagcagaagtacccggaacaaccagggaggtttgccaagctgctg
ctgcgcctcccagccttgcgctccatcggcttgaaatgcctggagcacctcttcttcttc
aagctcatcggggacacacccattgacaccttcctaatggagatgttggagaccccgctg
cagatcacctga

DBGET integrated database retrieval system