KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005702
Entry
103005702         CDS       T03086                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04140  Autophagy - animal
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04722  Neurotrophin signaling pathway
bacu04910  Insulin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05165  Human papillomavirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103005702 (BAD)
   04014 Ras signaling pathway
    103005702 (BAD)
   04370 VEGF signaling pathway
    103005702 (BAD)
   04024 cAMP signaling pathway
    103005702 (BAD)
   04022 cGMP-PKG signaling pathway
    103005702 (BAD)
   04151 PI3K-Akt signaling pathway
    103005702 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103005702 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    103005702 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103005702 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103005702 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103005702 (BAD)
   04919 Thyroid hormone signaling pathway
    103005702 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103005702 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005702 (BAD)
   05203 Viral carcinogenesis
    103005702 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103005702 (BAD)
   05212 Pancreatic cancer
    103005702 (BAD)
   05225 Hepatocellular carcinoma
    103005702 (BAD)
   05221 Acute myeloid leukemia
    103005702 (BAD)
   05220 Chronic myeloid leukemia
    103005702 (BAD)
   05218 Melanoma
    103005702 (BAD)
   05211 Renal cell carcinoma
    103005702 (BAD)
   05215 Prostate cancer
    103005702 (BAD)
   05213 Endometrial cancer
    103005702 (BAD)
   05223 Non-small cell lung cancer
    103005702 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103005702 (BAD)
   05014 Amyotrophic lateral sclerosis
    103005702 (BAD)
   05020 Prion disease
    103005702 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    103005702 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103005702 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103005702 (BAD)
   05161 Hepatitis B
    103005702 (BAD)
   05160 Hepatitis C
    103005702 (BAD)
   05162 Measles
    103005702 (BAD)
   05168 Herpes simplex virus 1 infection
    103005702 (BAD)
   05165 Human papillomavirus infection
    103005702 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103005702 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103005702 (BAD)
   01524 Platinum drug resistance
    103005702 (BAD)
   01522 Endocrine resistance
    103005702 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 103005702
NCBI-ProteinID: XP_007174379
UniProt: A0A383ZGV4
LinkDB
Position
Un
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHRQAAPGLLGEAGHQQGQPASSSH
HGGTGAVETRSRHSFYSAGTEDEAGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHGSFKGLPRPKSAGTATQMRQSPSWARFLQSWWNRNLGRGGPAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtcccagcaagcaccggcaagcg
gccccaggcctcctgggggaagctggtcaccagcaggggcagccagccagcagcagccac
catggaggcactggggctgtggagacccggagtcgccacagcttctactccgcggggacg
gaggatgaagcagggacggaggaggaggagcccagccccttccggggccgctcgcgctcg
gcgccccccaacctctgggctgcacagcgatatggccgcgagctccggaggatgagcgac
gagttccacggctccttcaagggacttcctcgcccgaagagcgcgggcacagcgacgcag
atgcgacaaagccccagttgggcgcgcttccttcagtcctggtggaaccggaacttgggg
agaggaggccccgccccctcccagtga

DBGET integrated database retrieval system