KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005777
Entry
103005777         CDS       T03086                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04068  FoxO signaling pathway
bacu04144  Endocytosis
bacu04218  Cellular senescence
bacu04350  TGF-beta signaling pathway
bacu04380  Osteoclast differentiation
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04659  Th17 cell differentiation
bacu04926  Relaxin signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05142  Chagas disease
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103005777 (TGFBR2)
   04350 TGF-beta signaling pathway
    103005777 (TGFBR2)
   04390 Hippo signaling pathway
    103005777 (TGFBR2)
   04068 FoxO signaling pathway
    103005777 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103005777 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103005777 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    103005777 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103005777 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103005777 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103005777 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103005777 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005777 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    103005777 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103005777 (TGFBR2)
   05212 Pancreatic cancer
    103005777 (TGFBR2)
   05225 Hepatocellular carcinoma
    103005777 (TGFBR2)
   05226 Gastric cancer
    103005777 (TGFBR2)
   05220 Chronic myeloid leukemia
    103005777 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103005777 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103005777 (TGFBR2)
   05161 Hepatitis B
    103005777 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103005777 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103005777 (TGFBR2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103005777 (TGFBR2)
Protein kinases [BR:bacu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103005777 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103005777
NCBI-ProteinID: XP_007191598
UniProt: A0A384AWF2
LinkDB
Position
Un
AA seq 549 aa
MLVNHVMHLFSLPVNSDMMVTDDNGAVKLPQLCKFCDVRLSTCDNQKSCWSNCSITAICE
KPQEVCVAVWRKNDENITLETVCHDPKVTYHGFVLDDAASPKCIMKEKKGSGETFFMCSC
SSEECNDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIVTFYCYRVHRQQKLS
PAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEV
YKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELG
KQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGSSLARGIAHLHSDHTLCGRPKMPIVHR
DLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLEN
VESFKQTDVYSMALVLWEMTSRCSAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRP
EIPSSWLNHQGIQMVCETLAECWDHDPEARLTAQCVAERFSELEHLDRLSGRSSSEEKIP
EDGSLNTTK
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgttggttaatcacgtaatgcatctcttttccctcccagttaacagtgacatgatggtc
actgacgacaatggtgccgtcaagttgccgcagttgtgtaaattctgcgatgtgagattg
tccacctgtgacaaccagaagtcctgctggagcaactgcagtatcacggccatctgtgag
aagccgcaagaggtctgcgtggctgtctggagaaagaatgatgagaacatcacgctggag
acggtctgccatgaccccaaggtcacctaccatggatttgtccttgacgacgctgcttct
ccaaagtgtattatgaaggaaaaaaaggggtctggagagactttcttcatgtgttcctgc
agctccgaagagtgcaatgaccacatcatcttctccgaagaatacgccaccaacaacccc
gacttgctgttggtcatcttccaagtgacaggtgtcagcctcctgccgccgctgggcatc
gccattgctgtcatcgtcaccttctactgctaccgcgtccaccggcagcagaagctgagc
ccggcctgggactcgggcaagccgcgcaagctgatggagttcagtgagcacctggccatc
atcctggaggatgaccgctccgacatcagctccacctgcgccaacaacatcaatcacaac
acggagttgctgcccattgagctggacaccctggtgggcaaagggcgcttcgccgaggtc
tacaaggccaagctgaggcagaacacgtctgagcagtttgagaccgtggccgtcaagatc
ttcccctatgaagaatatgcctcctggaagacggagaaggacatcttctcggacatcaac
ctcaagcacgagaacatcctgcagttcctgacagctgaggagcgcaagacggagctgggc
aagcagtactggctgatcaccgccttccacgccaagggcaacctgcaggagtacctgacg
cgccacgtcatcagctgggaggacctgcgcaggctgggcagctcgctggcccgtggcatc
gcgcacctgcacagcgaccacacgctgtgcggccgacccaagatgcccatcgtgcacagg
gacctcaagagctccaacatcctggtcaagggagacctcacctgctgcctctgtgacttc
ggcctctccctgcggctggaccccactctgtctgtggatgacctggccaacagtgggcag
gtgggaacggcgagatacatggctccagaggtcctagagtccaggatgaatctggagaat
gtcgagtccttcaagcagacggatgtctactccatggccctggtgctctgggaaatgaca
tctcgctgcagcgcagtgggagaagtgaaggattatgagcctccattcggttccaaggtg
cgagagcatccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgaggacgaccc
gaaatccccagctcctggctcaaccaccagggcatccagatggtgtgcgagacgctggcc
gagtgctgggaccacgaccccgaggcccggctcacggcgcagtgtgtggccgagcgcttc
agtgagctggagcatctggacagactctcgggcaggagcagttcggaggagaagattccc
gaagacggctccctgaacactaccaagtag

DBGET integrated database retrieval system