KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005791Help
Entry
103005791         CDS       T03086                                 

Gene name
GANC
Definition
(RefSeq) glucosidase, alpha; neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103005791 (GANC)
   00500 Starch and sucrose metabolism
    103005791 (GANC)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103005791 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Peptidase_C2 Calpain_III Calpain_u2 Gal_mutarotas_2 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_7 DUF5110
Motif
Other DBs
NCBI-GeneID: 103005791
NCBI-ProteinID: XP_007173669
LinkDB All DBs
Position
Un
AA seq 1659 aa AA seqDB search
MDAAEKEEISVEDEAVDKNIFKDCSKIAFYRRQKQRLSKKSTYRALLDSVTAGKESTRFQ
IINEAAKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPSPVRLISCSGDTGS
LVLANGKGDLKCRITANPFKIDLVSEEEVVMSINSLGQLYFEQLQIPPKQRATKENEEDT
SDDTTQENQEELGLWEEKFRNFVDVKDNGPASIGLDFSLHGFEHVYGIPQHAESHQLKNT
SDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEINTEPTV
KYALTQMGPVAAKQKVRSQTDVHWMSESGIIDVFLLTGPTPSDIFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEHDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYAKAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTSPKVREWYSSLFAFSVYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSVTGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATKNTKRREPWLFGE
EHTRLIQEAIRERYTLLPYWYSLFYSAHVASQPVMRPLWVEFPDELETFSMEDEYMLGSA
LLVHPVTEPKATVVDVFLPGSNEVWYDSKTFAHWEGACTVKIPVALDTIPVFQRGGSVVP
IKTTIGRSTGCMTDSPYGLWVALSTKGSAVGELYLDDGHSFQYLHQKQFLHRKFSFASGV
LINRSKSSCGSWLWWTWGGQFLTEVIPGCRFQFEQEICENPRFIVGGANRTDICQGDLGD
CWFLAAIACLTLNKRLLFRVIPHEQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNE
LVFTKSNHHNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEIKDAPRDM
YKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMRDLIERMVRNMNNSHLRDSDLIPEG
CSDDRPTRTIVPVQYETRMACGLVKGHAYSVTGLEEALYKGEKVKLVRLRNPWGQVEWNG
SWSDSWKDWSFVGKNEKARLQHQVTEDGEFWMSYDDFIYHFTKLEICNLTADALESDKLQ
TWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQK
NRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSERF
RLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKPKPIIFVSD
RANSNKELGVDQESEEGKDKTSPDKQAKSPQSEPSNADQESEEQQRFRNIFRQIAGDDME
VCADELKNILNRVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAW
QKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKYMNIDFDSFICCFV
RLEGMFRAFNAFDKDGDGIIKLNVLEVKPNRSSTIPLYLKIRGRGIHEEDWTHYVLLTSQ
RWWRDGTGKEHKGELMAQQDVAHRECVLGEGSKEASVLQ
NT seq 4980 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagcggctctccaagaag
tctacctatcgggcattactagactcagtcacggcaggcaaagagagcaccaggttccaa
atcatcaacgaagcagctaaggttcctctcctggctgaagtttatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaacacccttgaaacccagatatgaagttcctgat
gtcctcacaagcaagccaagccctgtaaggctgatttcatgctcaggagatacaggcagt
ctcgtattggcaaatggaaaaggagatctgaagtgtcgcatcacagcaaacccattcaag
atagacttggtatctgaagaagaggttgtgatgagcataaactccctgggccaattgtac
tttgagcagctgcagattcctcccaagcaaagagctaccaaggaaaatgaggaggataca
tcagatgacaccactcaggaaaatcaagaggaactgggcttgtgggaagagaaattcaga
aattttgtggatgtcaaagataatggtcctgcctccattggtttggatttctccttgcat
gggtttgagcatgtctatgggatcccgcaacatgcagaatcacaccaacttaaaaatacc
agtgatggagatgcttaccgtctttataacctagatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcaggactcta
ggcattttttggctaaatgcctcagaaacactagtggagatcaatacagaacctactgta
aagtatgcattgacccagatgggcccagttgctgctaaacaaaaggtcagatctcaaact
gatgtgcactggatgtcagagagtggaatcattgatgtttttttgctgacaggacctaca
ccttctgacatcttcaagcagtactcataccttacaggcacacaagccatgccccctctc
ttctccttgggctaccatcagtgccgctggaactacgaagatgagcatgatgtaaaggca
gtggatgcaggatttgatgaacatgacattccttacgatgtcatgtggctggacatcgag
cacactgaaggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagagctgctcaggagcaaaaaacgtaagcttgtggtcattagtgacccccacatc
aagattgatcccgactactcagtgtatgctaaggccaaagaacagggtttctttgtgagg
aatcatgaagggggagactttgaaggtgtatgctggcctggtctctcctcttacctggat
tttaccagtcccaaagtcagagagtggtattccagtctttttgctttctctgtttatcag
ggatctactgacatcctctacatatggaacgacatgaatgagccctctgtctttagaggg
ccagaactaaccatgcagaagaatgccattcatcatggcaactgggagcaccgagaactt
cacaacatctatggcttttatcaacaaatggccactgcagaaggactgatccaacgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaaatat
ggtgctgtgtggacaggtgacaacacagccgagtggagttacctgaaaatttctatccct
atgttactcaccctcagcgtgactgggatctctttttgtggagcggatgtaggcggcttc
atcgggaatccagaggcagagctgctagtgcggtggtaccaggccggagcctaccagccc
ttcttccgtggccatgccaccaagaacaccaagcgacgggaaccctggctctttggggag
gagcacacccggctcatccaagaagccatcagagagcgctacaccctcctgccctactgg
tattctctgttctactctgcacacgtggcttcccaacccgtcatgaggcctctgtgggta
gagttccctgatgaattagagactttcagtatggaagatgaatacatgctgggaagcgct
ttattggttcacccagtcacagaaccaaaagctactgtggttgatgtgtttctgccagga
tcaaatgaggtctggtatgactctaagacatttgctcattgggaaggagcatgtactgta
aagatcccagtagccttggacacaataccagtgtttcaacgaggtggaagtgtggtacca
ataaagacaactataggaagatccacgggctgcatgactgattccccatatgggctctgg
gtggccctaagcactaagggttctgctgtgggtgaattatatctcgatgatggtcattca
ttccaatacctccaccagaagcagttcttgcacaggaagttttcattcgcctcaggtgtt
ttgatcaacaggtctaaatcatcctgtggatcctggctatggtggacctggggtggtcag
ttcctgacagaagtgatcccaggatgtaggttccagtttgaacaggaaatttgtgagaat
ccccgatttatcgttggcggagccaacagaactgacatctgtcaaggagatctaggggac
tgctggtttctcgcagccatcgcttgcctgaccctgaacaagcgactgcttttccgggtc
ataccccatgaacagagtttcaccgaaaactacgcggggatctttcacttccagttctgg
cgctatggagactgggtggacgtggttattgatgactgcctgccaacttacaacaatgaa
ctggttttcaccaaatccaaccaccacaatgagttctggagtgctctgctggagaaggct
tatgctaagctccatggttcatatgaagccctgaaaggtgggaacactacagaggccatg
gaggacttcacaggaggagtaacagagttttttgaaatcaaggatgctcccagagacatg
tacaagatcatgaagaaagccatcgagaggggctccctcatgggttgctccattgatgat
ggcacaaacatgacctatggaacctctccttctggtctgaacatgagggacttgattgag
cggatggtgaggaatatgaataactcgcatctcagggattcagacctcatccctgaggga
tgctcagatgacagaccgacccggacaattgttccagttcagtacgagacaagaatggcc
tgcgggctggtcaaaggccatgcctactcagtcactgggctggaggaggccctgtacaag
ggtgagaaagtgaagctggtgcggctgcggaacccctggggccaggtggagtggaatggc
tcctggagtgacagttggaaggactggagctttgtgggcaagaacgagaaggcccgtctg
caacaccaggtcacggaggatggagagttctggatgtcctatgacgatttcatctaccat
ttcacaaagctggagatctgcaacctcacagctgatgccctggagtccgacaagcttcag
acttggacagtgtccgtgaatgagggccgctgggtgaggggctgctctgctggaggctgc
cgcaacttcccagacactttctggaccaaccctcagtaccgtctgaagctcctggaggag
gacgacgaccctgacgactccgaggtgatctgcagcttcctggtggccctgatgcagaag
aaccggcggaaggaccggaagctgggggccaacctcttcaccatcggcttcgccatctac
gaggttcccaaagagatgcacggcaacaagcagcacctgcagaaggacttcttcctgtac
aacgcctccaaggccaggagcaaaacctacatcaacatgcgggaggtgtctgagcgcttc
cgcctgcctcccagcgagtacgtcattgtgccctccacctacgagccccaccaggaggga
gaattcatcctccgggtcttctctgaaaagaggaacctctctgaggaagttgagaataca
atctccgtggatcggccagtgaagaagaaaaaacccaagcctatcatcttcgtttcagac
agagcaaacagcaacaaggagctgggtgtggaccaggaatcagaggagggcaaagataaa
acaagccctgataagcaagcgaaatccccacagtcagagcccagcaacgctgaccaggaa
agtgaggaacagcagcgattccggaacattttcaggcagatagcaggcgatgacatggag
gtctgtgcagatgagctcaagaatatccttaacagagttgtgaacaaacataaagacctg
aagacacaaggcttcacgctggagtcctgccgtagcatgattgctctcatggacacagac
ggctctgggagactgaacctgcaagagttccatcacctctggaagaagattaaggcctgg
cagaaaattttcaagcactatgacacagaccaatccggcaccatcaacagctacgagatg
cgaaatgcagtcaatgacgcaggcttccacctcaacaaccagctctacgacatcatcacc
atgcgctatgcagacaagtacatgaacatcgacttcgacagtttcatctgctgcttcgtc
aggctggagggcatgttcagagcttttaatgcatttgacaaggatggtgacggtatcatc
aaactcaacgttctagaggtaaagcctaatagaagcagtacaatccccctgtaccttaaa
attcgaggtagaggaatccatgaggaagactggacacactatgtgctcctcacttcccaa
cggtggtggagggatgggacgggaaaggaacataaaggggagctcatggctcagcaggat
gtggctcatagggaatgtgtactgggggaaggctccaaagaggcctcagttctacaatga

DBGET integrated database retrieval system