KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005897
Entry
103005897         CDS       T03086                                 

Gene name
TNF
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01523  Antifolate resistance
bacu04010  MAPK signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04061  Viral protein interaction with cytokine and cytokine receptor
bacu04064  NF-kappa B signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04150  mTOR signaling pathway
bacu04210  Apoptosis
bacu04217  Necroptosis
bacu04350  TGF-beta signaling pathway
bacu04380  Osteoclast differentiation
bacu04612  Antigen processing and presentation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04640  Hematopoietic cell lineage
bacu04650  Natural killer cell mediated cytotoxicity
bacu04657  IL-17 signaling pathway
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04940  Type I diabetes mellitus
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05134  Legionellosis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05143  African trypanosomiasis
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05205  Proteoglycans in cancer
bacu05310  Asthma
bacu05321  Inflammatory bowel disease
bacu05322  Systemic lupus erythematosus
bacu05323  Rheumatoid arthritis
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103005897 (TNF)
   04350 TGF-beta signaling pathway
    103005897 (TNF)
   04064 NF-kappa B signaling pathway
    103005897 (TNF)
   04668 TNF signaling pathway
    103005897 (TNF)
   04071 Sphingolipid signaling pathway
    103005897 (TNF)
   04150 mTOR signaling pathway
    103005897 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103005897 (TNF)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103005897 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103005897 (TNF)
   04217 Necroptosis
    103005897 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103005897 (TNF)
   04620 Toll-like receptor signaling pathway
    103005897 (TNF)
   04621 NOD-like receptor signaling pathway
    103005897 (TNF)
   04622 RIG-I-like receptor signaling pathway
    103005897 (TNF)
   04625 C-type lectin receptor signaling pathway
    103005897 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    103005897 (TNF)
   04612 Antigen processing and presentation
    103005897 (TNF)
   04660 T cell receptor signaling pathway
    103005897 (TNF)
   04657 IL-17 signaling pathway
    103005897 (TNF)
   04664 Fc epsilon RI signaling pathway
    103005897 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103005897 (TNF)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103005897 (TNF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103005897 (TNF)
  09163 Immune disease
   05310 Asthma
    103005897 (TNF)
   05322 Systemic lupus erythematosus
    103005897 (TNF)
   05323 Rheumatoid arthritis
    103005897 (TNF)
   05321 Inflammatory bowel disease
    103005897 (TNF)
   05330 Allograft rejection
    103005897 (TNF)
   05332 Graft-versus-host disease
    103005897 (TNF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103005897 (TNF)
   05014 Amyotrophic lateral sclerosis
    103005897 (TNF)
   05020 Prion disease
    103005897 (TNF)
   05022 Pathways of neurodegeneration - multiple diseases
    103005897 (TNF)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103005897 (TNF)
   05410 Hypertrophic cardiomyopathy
    103005897 (TNF)
   05414 Dilated cardiomyopathy
    103005897 (TNF)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103005897 (TNF)
   04940 Type I diabetes mellitus
    103005897 (TNF)
   04932 Non-alcoholic fatty liver disease
    103005897 (TNF)
   04931 Insulin resistance
    103005897 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103005897 (TNF)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103005897 (TNF)
   05135 Yersinia infection
    103005897 (TNF)
   05133 Pertussis
    103005897 (TNF)
   05134 Legionellosis
    103005897 (TNF)
   05152 Tuberculosis
    103005897 (TNF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103005897 (TNF)
   05170 Human immunodeficiency virus 1 infection
    103005897 (TNF)
   05161 Hepatitis B
    103005897 (TNF)
   05160 Hepatitis C
    103005897 (TNF)
   05171 Coronavirus disease - COVID-19
    103005897 (TNF)
   05164 Influenza A
    103005897 (TNF)
   05168 Herpes simplex virus 1 infection
    103005897 (TNF)
   05163 Human cytomegalovirus infection
    103005897 (TNF)
   05169 Epstein-Barr virus infection
    103005897 (TNF)
   05165 Human papillomavirus infection
    103005897 (TNF)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103005897 (TNF)
   05144 Malaria
    103005897 (TNF)
   05145 Toxoplasmosis
    103005897 (TNF)
   05140 Leishmaniasis
    103005897 (TNF)
   05142 Chagas disease
    103005897 (TNF)
   05143 African trypanosomiasis
    103005897 (TNF)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103005897 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103005897 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103005897 (TNF)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Tumor necrosis fators
   103005897 (TNF)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Cytokines
   103005897 (TNF)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 103005897
NCBI-ProteinID: XP_007194038
UniProt: A0A384B3B3
LinkDB
Position
Un
AA seq 233 aa
MSTESMIRDVELAEEALSKTAGGSQGSRRCLCLSLFSFFLVAGATTLFCLLHFGVIGPQR
EEFPTGYSIISPLAQTLRSSSETSSNKPVAHVVANLSAQGQLRWLNTYANTLLANSVKLE
DNQLVVPTDGLYLIYSQVLFRGQGCPSTHLFLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggatgtggagctggcagaggaggcgctctccaagacg
gcagggggctcccagggttccagaaggtgcttgtgtctcagcctcttctccttcttcctg
gtcgcaggagccaccacgctcttctgcctgctgcacttcggggtaatcggcccccagagg
gaagagttcccaactggctactccatcatcagccctctggctcagacactcagatcatct
tctgaaacctcaagtaacaagcccgtagcccatgttgtagccaacctcagtgctcagggg
cagctccggtggctgaacacatatgccaacaccctcctggccaacagcgtgaagctggaa
gacaaccaactggtggtgccgacagacgggctgtacctcatctactcccaggtcctcttc
aggggccaaggctgcccttccacccacttgttcctcacccacaccatcagccgcatcgct
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag
acgccagagggggctgaggccaagccctggtatgagcccatctacctgggaggggtcttc
cagctggagaagggtgatcgactcagtgctgagatcaacctgcccgactatctggacttt
gctgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system