KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006014
Entry
103006014         CDS       T03086                                 

Gene name
AXIN1
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103006014 (AXIN1)
   04390 Hippo signaling pathway
    103006014 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103006014 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006014 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103006014 (AXIN1)
   05225 Hepatocellular carcinoma
    103006014 (AXIN1)
   05226 Gastric cancer
    103006014 (AXIN1)
   05217 Basal cell carcinoma
    103006014 (AXIN1)
   05213 Endometrial cancer
    103006014 (AXIN1)
   05224 Breast cancer
    103006014 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103006014 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    103006014 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103006014 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103006014 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103006014 (AXIN1)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103006014 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Sec16
Other DBs
NCBI-GeneID: 103006014
NCBI-ProteinID: XP_007181868
UniProt: A0A384A3G9
LinkDB
Position
Un
AA seq 830 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPISHSFCSGKGAGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKDCIMKQQIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGVPGYLPT
LNEDEEWKCDQDVDEDDGRDPAPPSRLTQKLLLETATPRASSSRRYSEGREFRYGSWREP
VNPYYVNSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGVPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEVRVEPQKFAAELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDVSSGPPGASHKLPSAPAWHHFPPRYADMSCVGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDSAHMPKMGVLGGTVPGHGKHVPKSGAKLDTVGLHLHRHGHHHGHH
GSARPKEPAEAEASRRVQSSFAWGPELHGHAAKPRSHVESMGAAPTTSDSLAYSGKASMT
SKRNSKKAESGKSTSVEAPGPSEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGAKKQQA
HESSRPLSIERPGAVHPWVSAQLRTSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEE
EEKRASKAPSRQRTKSQRKAGGGSAQSCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKE
LLTKKGNYRYYFKKVSDEFECGVVFEEVREDGAVLPVFEEKVIGKVEKVD
NT seq 2493 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgcc
ccccgacccccagtgcctggtgaggagggtgaactggtgtccacggaccccaggcccatc
agccacagcttctgctctgggaaaggtgccgggattaaaggtgagacttcaacagccact
ccgaggcgctcagatctggacctggggtacgagcctgagggcagcgcttcgcccacccct
ccgtacttgaagtgggccgagtcgctgcactccctactggacgatcaagacgggataaac
ctgtttaggactttcctgaagcaggaggactgtgccgatctcctggacttctggtttgcc
tgcagcggcttcaggaaactggagccctgtgactcgaatgaggagaagaggctgaagctg
gccagagctatctaccgcaagtacatcctcgataacaatggcattgtgtccaggcagacc
aagccagccaccaagagcttcataaaggactgcatcatgaagcagcagatcgatcccgcc
atgttcgaccaggcccagacggaaatccagtctaccatggaggagaacacctacccctcg
ttcctcaagtccgatatttatttggagtacacgaggacaggctcggagagcccaaagctc
tgcagtgaccagagctctgggtcggggacagggaagggagtacctggatacctacccact
ttgaacgaagatgaggaatggaagtgtgaccaagatgtagacgaagacgatggcagagac
cctgctccccccagcaggctcacacagaagctgctcctggaaaccgccaccccgagggcc
tcctcaagtagacggtacagcgagggcagagagttcaggtatggatcctggcgggagcct
gtcaacccctactacgtcaactctggctatgccctcgccccagccaccagcgccaacgac
agtgagcagcagagcctgtccagcgatgctgacagcctgtccctcaccgacagcagcgtg
gatggagtcccaccttacagaatccgcaagcaacaccgccgggagatgcaggagagcgtc
caggtcaacgggcgcgtgcctctacctcacattcctcgcacgtaccgaatgccaaaggaa
gtccgtgtggagccccagaagtttgccgcagagctcatccaccgcctggaggccgtgcag
cggacgcgggaggctgaggagaagctggaggagcggctgaagcgcgtccggatggaggaa
gaaggtgaggatggtgatgtgtcctctggccccccaggggccagtcacaagctgccttcg
gccccggcctggcaccacttcccaccgcgctatgcggacatgagctgtgtggggctgcgg
gacgcacacgaggagaaccctgagagcatcctggatgagcacgtgcagcgagtcatgagg
acaccgggctgccagtcgccggggcccggccaccgctccccggacagtgcgcacatgccc
aagatgggggtgctagggggtacagtgcctgggcatggaaagcacgtgcccaagtcgggc
gcgaagctggacacagttggcctgcacctccacagacacggccaccaccatggccaccat
ggctcagctaggcccaaggagccagctgaggccgaggcctcccgccgggtccagagcagc
ttcgcatggggcccagagctgcacggccacgcggccaagccccgaagccacgtggagagc
atgggcgccgcccccaccaccagtgacagcctggcctacagcgggaaggcaagcatgacc
tccaaaagaaactccaagaaggccgagtcggggaagagcaccagcgtggaggcgccaggc
ccctctgaggacgcagagaagaaccagaaaatcatgcagtggatcattgagggcgagaag
gagatcagcaggcaccggaaggctggccacgggtcgtccggggcaaaaaagcagcaggcc
cacgagagctcccggcccttgtccatcgagcgccccggggccgtgcacccctgggtcagc
gcccagctccggacctccgtgcagccctcgcatctcttcatccaggaccccacgatgccg
cccaacccggcccccaaccctctgacgcagctggaggaggcccgccggcgcctggaggag
gaggagaagagggccagcaaggcgccctcgaggcagaggacaaaatcgcagaggaaggca
ggcggtgggagtgcccagtcgtgcgacagcatcgtcgtggcctactatttctgtggggag
cccatcccctaccggaccctggtgaggggccgtgcggtcaccctgggccagttcaaggag
ctgctgaccaagaaaggcaactacagatactacttcaagaaggtgagcgacgagttcgaa
tgcggcgtggtgttcgaggaggtgcgcgaggacggggccgtgctgcccgtcttcgaggag
aaggtcatcggcaaggtggagaaggtggactga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006133
Entry
103006133         CDS       T03086                                 

Gene name
AXIN2
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103006133 (AXIN2)
   04390 Hippo signaling pathway
    103006133 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103006133 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006133 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103006133 (AXIN2)
   05225 Hepatocellular carcinoma
    103006133 (AXIN2)
   05226 Gastric cancer
    103006133 (AXIN2)
   05217 Basal cell carcinoma
    103006133 (AXIN2)
   05213 Endometrial cancer
    103006133 (AXIN2)
   05224 Breast cancer
    103006133 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103006133 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    103006133 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103006133 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103006133 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103006133 (AXIN2)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103006133 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD DUF2484
Other DBs
NCBI-GeneID: 103006133
NCBI-ProteinID: XP_007186015
UniProt: A0A384AFA5
LinkDB
Position
Un
AA seq 543 aa
MSSAVLVPRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGPAAKPLPVPSSARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDAKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSVMFDQAQTEIQA
VMEDNAYQMFLTSDIYLEYVRSGGENPACVSSGGLGSLKLVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATVSVRSTETVENGYRRSDPVNPYHVGSGCVFAPAASANDSEIS
SDALTDDSMSMTDSSVDGIPPYLGGSKKQLQREMHRSVKANGQVCLPHFPIRFRQLSAAV
LLLAGSSLLRFLYKEMGGGAGNTRGSGAAVDNAASKVRSVRPGETLPLRLIWALCCAASQ
QRDRHHSAAGPPGAAPLSSPSLASEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASNEFACGAVFEEVWDDEVVLPTYEGRILGKVE
RID
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgagcagcgctgtgttggtgcctcgcctcccagaccccagcagcagcttccgcgaggac
gccccgcggcccccagtgccgggcgaagaaggggagaccccaccgtgccagcccggggtg
ggaaagggcccggccgccaaacccctgcctgtcccctccagtgccaggcggaatgaggac
gggttgggcgagccggaggggcgggcgtctccggattcccctctgaccaggtggaccaag
tccctgcactccttgctgggtgaccaagacggtgcttatctcttccggactttcctggag
agggagaaatgcgtggataccttagacttctggtttgcctgcaatggattcaggcagatg
aacctgaaggatgccaaaactttacgagtagccaaagcgatctacaaaaggtacatcgag
aacaacagcattgtctccaagcagctgaaacctgccaccaagacctacatcagagatggc
atcaagaagcagcagatcgattctgtcatgtttgaccaggcgcagactgagatccaggcg
gtgatggaggacaatgcctaccagatgtttctgacttctgatatatacctcgaatacgtg
aggagtgggggtgaaaacccagcctgcgtgagcagcggggggctggggagcctgaagctc
gtgtgtggctacctccccacgctgaacgaggaagaggagtggacgtgcgccgacttcaag
tgcaaactctcccccaccgtggttggcttgtccagcaaaactctgagggctacagtcagt
gtgaggtccacagaaactgtcgagaatggatacaggaggagcgatccggtgaatccgtac
cacgtgggttccggctgcgtcttcgcgccagccgccagcgccaacgacagcgagatatcc
agtgacgcgctgaccgacgattccatgtccatgacggacagtagcgtagatggaatccct
ccttacctcggggggagtaagaaacagctccagagagaaatgcatcgcagtgtgaaggcc
aacggccaggtgtgcctacctcatttcccgatccgcttcaggcagctgagcgcagcagtt
ctgctattagccggcagcagcttgcttcgttttctgtacaaagagatgggaggaggggcg
gggaacacgagggggtccggggcagcggtagacaacgccgcctcaaaggtgcgcagtgtg
cggccaggagagacattaccgctgcgtctgatctgggccctgtgctgcgcggccagtcag
cagagggacaggcaccactcggccgccggtccgccaggagccgcgcccttgtccagccca
agcctggcttcggaagatcacaaagagccaaagaagctggcaggggtgcacgctctccag
gccagtgagctggtcgtcacctactttttctgcggggaggaaatcccgtaccggaggatg
ctgaaggctcagagcctgaccctgggccacttcaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcgagcaacgagttcgcgtgtggagccgtgtttgaggag
gtctgggacgacgaggtggtgctgcccacgtacgagggacggatcctggggaaggtggag
aggatcgactga

DBGET integrated database retrieval system