KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006296
Entry
103006296         CDS       T03086                                 

Gene name
ETS1
Definition
(RefSeq) ETS proto-oncogene 1, transcription factor
  KO
K02678  C-ets-1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04014  Ras signaling pathway
bacu04218  Cellular senescence
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103006296 (ETS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103006296 (ETS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006296 (ETS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    103006296 (ETS1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103006296 (ETS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103006296 (ETS1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    103006296 (ETS1)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 103006296
NCBI-ProteinID: XP_007183426
UniProt: A0A384A7U3
LinkDB
Position
Un
AA seq 485 aa
MSYLVESAVSGPAPYSAVRPAAVRQGPLSSYEDPRMACGFQSAYHPPRACYPFWDEMATQ
EVPTGLEHCGSDMECADVPLLTPSSKEMMSQALKATFSGFSKEQQRLGIPKDPRQWTETH
VRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKED
VKPYQVNGVNPPYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEEL
LSLKYENDYPSVILRDPLQTDTLQTDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESVE
SYESCDRLTQSWSSQSSFSSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNK
DKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWG
KRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
PDADE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgagctaccttgtggagtctgcagtgagtggccccgccccctactcagcggtgcgaccc
gcagcagtgaggcagggacctctcagctcttacgaagatcctagaatggcctgtggtttc
cagtctgcttatcacccgccaagagcttgctaccccttctgggatgagatggccactcag
gaagtgcccactggtcttgaacactgcggctcagatatggaatgtgcagatgttccgctc
ttaactccaagcagcaaagaaatgatgtctcaagccctgaaagctaccttcagtggtttc
tctaaagagcagcaacgcctgggaattccaaaagacccccggcagtggacagagacccat
gttcgggactgggtgatgtgggctgtcaatgagttcagcctaaagggtgtggacttccag
aagttctgcatgaacggggcagccctctgcgcgctggggaaagactgctttctcgagctg
gccccagacttcgttggggacatcttgtgggagcatctggagatcctgcagaaagaggat
gtgaagccataccaagttaatggagtcaaccctccgtaccccgagtcccgctatacctcg
gattacttcattagctacggtatcgagcatgcccagtgtgtccctccctcggagttctcc
gagcccagcttcattacagagtcctaccagaccctccatcccatcagctcggaggagctc
ctctccctcaagtatgagaacgactatccctcggtcatcctccgggaccctctgcagacg
gacaccttgcagactgactactttgccatcaaacaagaagtggtgaccccagacaacatg
tgcatggggaggaccagtcgtggcaagctcgggggccaggactcctttgagagcgtagag
agctacgagagctgcgaccgcctcacccagtcctggagcagccagtcatccttcagcagc
ctgcagcgcgtcccgtcctacgacagcttcgactcggaggactatccagccgccctgccc
aaccacaagcccaagggcaccttcaaggactatgtgcgcgaccgtgctgacctcaacaag
gacaagcctgtcatccctgctgcggccctggctggctacacaggcagtggaccgatccag
ctgtggcagtttcttctggaattactcaccgataaatcctgtcagtcttttatcagctgg
acaggagatggctgggaattcaagctttctgacccagatgaggtggccaggagatgggga
aaaaggaaaaacaaacctaagatgaattatgagaaactgagccgtggccttcgctactat
tatgacaaaaacatcattcacaagacggcgggtaaacgctatgtgtaccgttttgtgtgt
gacctgcagagcctcctggggtacacgcccgaggagctccacgccatgctggacgtcaag
cccgacgccgatgagtga

DBGET integrated database retrieval system