KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006526Help
Entry
103006526         CDS       T03086                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03030  DNA replication
bacu03410  Base excision repair
bacu03420  Nucleotide excision repair
bacu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103006526 (LIG1)
   03410 Base excision repair
    103006526 (LIG1)
   03420 Nucleotide excision repair
    103006526 (LIG1)
   03430 Mismatch repair
    103006526 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bacu03032]
    103006526 (LIG1)
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103006526 (LIG1)
Enzymes [BR:bacu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103006526 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103006526 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103006526 (LIG1)
DNA replication proteins [BR:bacu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103006526 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103006526 (LIG1)
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103006526 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     103006526 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     103006526 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 103006526
NCBI-ProteinID: XP_007168272
UniProt: A0A383YZG1
LinkDB All DBs
Position
Un
AA seq 918 aa AA seqDB search
MQRSIMSFFQPTKEGKVKKPEKELSNSTRETESPPKVALKERNRVEPEGDSPVKRPGRKA
ARVLGSEGEEEEEEAPKPPKSQKPAPDSPQVSPPSPGTPPESSPSHPSTSPTAVSPSGIP
KRRTARKQLSKRTFQDVLQEQGKDEDGGAKKKKEEEEEELETPTESLTEPEGGKKKEAEE
GDQPRSPPEPLKTSTKPPTESVSEPKVAVKQGPQEDGQAKPPSKAPKTLSSFFSPRKPAI
KKEAKEEGPSALRKDETKGHLDPSSYNPAKNNYHPVEDACWKVGQRVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVAALSPADLLPVLYLSLNRLGPPQQGLELGIGDGILLKAVAQ
ATGRQLEAVRAEAAEKGDVGLVAESSRSTQRLVLPPPALTAAGVLTKFRDIAQLAGSAST
AKKMDVIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLEHGLERLREHCRLSPGVPL
KPMLAHPTRGVSEVLRRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGRYPD
IISRIHKIKLPSVTSFILDAEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
AAYDEESEELQAICKLGTGFSDEELEEHHQSLQALVLPAPRSYVRADGAVAPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFVCVREDKKPEEATTSAQVACLYRKQ
SQIQNQHAEPDSDLEDFY
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtattatgtcatttttccagcccacgaaagagggcaaagtgaagaagcca
gagaaggagctatccaacagcaccagagaaacagagtcccctccaaaggtggcgctgaag
gagcggaatagagtggaacctgagggcgactctccagtgaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaggaggaggaggaggaagcccccaagccccccaaa
agccagaagcctgctccagattccccacaagtctcccctcccagtcctggcacaccgcct
gagagcagcccttcccaccccagcacctctcccacggctgtctccccatcagggatcccg
aagcgtcgcacggcccggaagcagctttccaaacggacatttcaggatgtcctgcaagag
cagggcaaggacgaggacgggggagccaagaagaagaaggaggaggaggaagaagaatta
gagacaccaacagaaagcctcacagagcctgaagggggcaagaagaaggaagcagaagaa
ggggaccagcccaggtcaccccctgagcccctgaagacctccacaaagcccccaacagaa
agcgtttcagagcccaaggtggccgtgaagcagggaccacaggaggacggccaggctaag
cctccctccaaagctcccaagacgctcagcagtttcttctctccccggaagccagcaatc
aaaaaagaagcgaaagaagagggacccagcgctctgagaaaggacgagaccaagggacac
ctggacccatccagctacaatcctgccaagaacaactaccatcccgtcgaagatgcttgc
tggaaggtgggccagagagtcccttacctggctgtggcccggacgtttgagaagatcgaa
gaggtttccgcgcggctccggatggtggagacactgagcaacctcctgcgctccgtggcg
gccctgtcacctgctgacctcctccccgtcctctacctcagcctcaaccgcctggggcca
ccccagcagggcctggagctcggcattggcgacggcatcctcctcaaggcggtggcccag
gccacaggccggcagctggaggcggtccgggccgaggcggccgagaagggcgacgtgggg
ctggtggccgagagcagccgcagcacccagaggctcgtgctgcccccgcccgccctcacc
gccgccggcgtcctcaccaagttccgggacatcgcgcagctggccggcagcgcttccaca
gccaagaagatggacgtcatcaaaggcctctttgtggcctgccgccactcagaagcacgg
ttcattgccagagccctgagtggacggctgcgcctcgggctggcagagcagtcggtgctg
gcggccctcgcccaggccgtgagcctcaccccgccaggtcaagaattccccccagctgtg
gtggatgctgggaagggcaagacagcagaggccagaaagacatggctggaggagcaaggc
atgatcctgaagcagacgttctgcgaggtgcccgacctggaccggatcgtccccgtgttg
ctggagcacggtctggagcggctccgggagcactgcaggctgagcccaggggtccccctg
aaaccaatgttggcccacccaacccggggcgtcagcgaggtcctgaggcgctttgaggag
gcagctttcacctgcgagtacaaatacgatgggcagagggcacagatccatgttctggaa
ggcggagaggtgaagatcttcagcaggaatcaggaggacaataccggaaggtaccccgat
atcatcagccgcatccacaagattaaactcccgtcagtcacatccttcatcctggacgcg
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaggtggacgcggcagagatccaggtgcaggtgtgtctgtacgccttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccgacgccggcag
ctgctccgggagaacttcgtggagacggagggcgagtttgtctttgccacctctctggac
accaaggacacggaccagatcgccgagttcttggagcagtcggtgaaagactcctgcgag
gggctgatggtgaagaccctggatgtggacgccacctacgagatcgccaagaggtcacac
aactggctcaagctgaagaaggactacctcgacggcgtgggcgacaccctggacctcgtg
gtgatcggcgcctacctgggccgggggaagcgggccggccggtatgggggcttcctgctg
gccgcctacgacgaggagagcgaggagctgcaggccatctgcaagctcggaacgggcttc
agtgacgaggagctggaggagcatcaccagagcctgcaggcgctggtgctgcccgcccca
cgctcctatgtccgggccgacggcgccgtggcccccgaccactggctggaccccagcgcc
gtgtgggaggtgaagtgcgcagacctctccctctcgcccatctacccggctgcccggggc
ctggtggatagcgagaagggaatctccctccgcttccctcggtttgtctgcgtccgtgag
gacaagaagccagaggaggccaccaccagtgcccaggtggcctgtctgtaccggaagcaa
agtcagattcagaaccagcacgcagagccagactctgacctggaagatttctactag

DBGET integrated database retrieval system