KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006782
Entry
103006782         CDS       T03086                                 

Gene name
CXCL8, IL8
Definition
(RefSeq) C-X-C motif chemokine ligand 8
  KO
K10030  interleukin 8
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04061  Viral protein interaction with cytokine and cytokine receptor
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04218  Cellular senescence
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05134  Legionellosis
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05144  Malaria
bacu05146  Amoebiasis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05219  Bladder cancer
bacu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103006782 (CXCL8)
   04072 Phospholipase D signaling pathway
    103006782 (CXCL8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103006782 (CXCL8)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103006782 (CXCL8)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103006782 (CXCL8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103006782 (CXCL8)
   04621 NOD-like receptor signaling pathway
    103006782 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    103006782 (CXCL8)
   04657 IL-17 signaling pathway
    103006782 (CXCL8)
   04062 Chemokine signaling pathway
    103006782 (CXCL8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006782 (CXCL8)
   05202 Transcriptional misregulation in cancer
    103006782 (CXCL8)
  09162 Cancer: specific types
   05219 Bladder cancer
    103006782 (CXCL8)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103006782 (CXCL8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103006782 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103006782 (CXCL8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103006782 (CXCL8)
   05135 Yersinia infection
    103006782 (CXCL8)
   05133 Pertussis
    103006782 (CXCL8)
   05134 Legionellosis
    103006782 (CXCL8)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103006782 (CXCL8)
   05171 Coronavirus disease - COVID-19
    103006782 (CXCL8)
   05164 Influenza A
    103006782 (CXCL8)
   05163 Human cytomegalovirus infection
    103006782 (CXCL8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103006782 (CXCL8)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103006782 (CXCL8)
   05144 Malaria
    103006782 (CXCL8)
   05142 Chagas disease
    103006782 (CXCL8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103006782 (CXCL8)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103006782 (CXCL8)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Chemokines
   103006782 (CXCL8)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Chemokines
   103006782 (CXCL8)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103006782
NCBI-ProteinID: XP_007179900
UniProt: A0A383ZXQ0
LinkDB
Position
Un
AA seq 101 aa
MTSKLAIALLAAFLLSAAVCKAAVLARMSSELRCQCINTHSTPFHPKFIKELRVIESGPH
CENSEIIVKLGNGKEVCLNPKEKWVQKVVQIFLKRAEKKDP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggctatcgctcttttggcagccttcctgctttctgcagctgtgtgt
aaagctgcagttctggcaagaatgagttcagaacttcgatgccaatgcataaatacacac
tccacacctttccaccccaaatttatcaaagaattgcgagtgattgagagtggaccacac
tgtgaaaattcagaaatcattgttaagcttggcaatggaaaagaggtctgcttaaacccc
aaggaaaagtgggtgcagaaggttgtgcagatatttttgaagagagctgagaagaaagat
ccatga

DBGET integrated database retrieval system