Balaenoptera acutorostrata scammoni (minke whale): 103007162 Help Entry 103007162         CDS       T03086                                  Definition (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04060   Cytokine-cytokine receptor interaction bacu04151   PI3K-Akt signaling pathway bacu04217   Necroptosis bacu04620   Toll-like receptor signaling pathway bacu04621   NOD-like receptor signaling pathway bacu04622   RIG-I-like receptor signaling pathway bacu04623   Cytosolic DNA-sensing pathway bacu04630   JAK-STAT signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu05152   Tuberculosis bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05162   Measles bacu05163   Human cytomegalovirus infection bacu05164   Influenza A bacu05165   Human papillomavirus infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05168   Herpes simplex virus 1 infection bacu05169   Epstein-Barr virus infection bacu05170   Human immunodeficiency virus 1 infection bacu05171   Coronavirus disease - COVID-19 bacu05200   Pathways in cancer bacu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103007162    04151 PI3K-Akt signaling pathway     103007162   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103007162  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103007162  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103007162    04621 NOD-like receptor signaling pathway     103007162    04622 RIG-I-like receptor signaling pathway     103007162    04623 Cytosolic DNA-sensing pathway     103007162    04650 Natural killer cell mediated cytotoxicity     103007162  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103007162   09163 Immune disease    05320 Autoimmune thyroid disease     103007162   09171 Infectious disease: bacterial    05152 Tuberculosis     103007162   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103007162    05161 Hepatitis B     103007162    05160 Hepatitis C     103007162    05171 Coronavirus disease - COVID-19     103007162    05164 Influenza A     103007162    05162 Measles     103007162    05168 Herpes simplex virus 1 infection     103007162    05163 Human cytomegalovirus infection     103007162    05167 Kaposi sarcoma-associated herpesvirus infection     103007162    05169 Epstein-Barr virus infection     103007162    05165 Human papillomavirus infection     103007162  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bacu04052]     103007162 Cytokines and growth factors [BR:bacu04052]  Cytokines   Interferons    103007162 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CoV_NSP2_N LexA_DNA_bind Motif Other DBs NCBI-GeneID:  103007162 NCBI-ProteinID:  XP_007198087 UniProt:  A0A384BEC7 LinkDB All DBs Position Un AA seq 104 aa AA seqDB search PGLRLFSTEGSAAAWDETLLDKFCTALSQQLTDLQACLMQEAGLEGTPLLKEDSILAVRK YFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTNLQERLRRKE NT seq 316 nt NT seq  +upstreamnt  +downstreamnt accagggcttcggctcttcagcacggagggctcggctgccgcttgggatgagaccctcct ggacaagttctgcactgcactttctcagcagctcactgacctgcaagcctgtctgatgca ggaggcggggctggaagggactcccctgctgaaggaggactccatcctggctgtgaggaa atacttccacagaatcactgtctatctgcaagagaagaaatacagcccttgtgcctggga gattgtcagagcagaagtcatgagatccttctcttcatcaacaaacttgcaagaaagact caggagaaaggaatga

Balaenoptera acutorostrata scammoni (minke whale): 103008826 Help Entry 103008826         CDS       T03086                                  Definition (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04060   Cytokine-cytokine receptor interaction bacu04151   PI3K-Akt signaling pathway bacu04217   Necroptosis bacu04620   Toll-like receptor signaling pathway bacu04621   NOD-like receptor signaling pathway bacu04622   RIG-I-like receptor signaling pathway bacu04623   Cytosolic DNA-sensing pathway bacu04630   JAK-STAT signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu05152   Tuberculosis bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05162   Measles bacu05163   Human cytomegalovirus infection bacu05164   Influenza A bacu05165   Human papillomavirus infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05168   Herpes simplex virus 1 infection bacu05169   Epstein-Barr virus infection bacu05170   Human immunodeficiency virus 1 infection bacu05171   Coronavirus disease - COVID-19 bacu05200   Pathways in cancer bacu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103008826    04151 PI3K-Akt signaling pathway     103008826   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103008826  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103008826  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103008826    04621 NOD-like receptor signaling pathway     103008826    04622 RIG-I-like receptor signaling pathway     103008826    04623 Cytosolic DNA-sensing pathway     103008826    04650 Natural killer cell mediated cytotoxicity     103008826  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103008826   09163 Immune disease    05320 Autoimmune thyroid disease     103008826   09171 Infectious disease: bacterial    05152 Tuberculosis     103008826   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103008826    05161 Hepatitis B     103008826    05160 Hepatitis C     103008826    05171 Coronavirus disease - COVID-19     103008826    05164 Influenza A     103008826    05162 Measles     103008826    05168 Herpes simplex virus 1 infection     103008826    05163 Human cytomegalovirus infection     103008826    05167 Kaposi sarcoma-associated herpesvirus infection     103008826    05169 Epstein-Barr virus infection     103008826    05165 Human papillomavirus infection     103008826  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bacu04052]     103008826 Cytokines and growth factors [BR:bacu04052]  Cytokines   Interferons    103008826 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  103008826 NCBI-ProteinID:  XP_007176876 UniProt:  A0A383ZP49 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MAPTLSFLLALLLLSCNSTCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG FPQEAFGGNQFQKAQAIAVVHETIQQTFRLFSTEGSAAAWDETLLDKFCTALSQQLTDLQ ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN LQERLRRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccaaccttgtccttcctcctggccctgctgctgctcagctgcaactccacctgc tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggaggcgtttggtggcaaccagttccagaaggctcaagccatcgctgtcgtc catgagacgatccagcagaccttccggctcttcagcacggagggctcggctgccgcttgg gatgagaccctcctggacaagttctgcactgcactttctcagcagctcactgacctgcaa gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaaatacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac ttgcaagaaagactcaggaggaaggaatga

Balaenoptera acutorostrata scammoni (minke whale): 103009695 Help Entry 103009695         CDS       T03086                                  Gene name IFNA7 Definition (RefSeq) interferon alpha 7   KO K05414   interferon alpha Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04060   Cytokine-cytokine receptor interaction bacu04151   PI3K-Akt signaling pathway bacu04217   Necroptosis bacu04620   Toll-like receptor signaling pathway bacu04621   NOD-like receptor signaling pathway bacu04622   RIG-I-like receptor signaling pathway bacu04623   Cytosolic DNA-sensing pathway bacu04630   JAK-STAT signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu05152   Tuberculosis bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05162   Measles bacu05163   Human cytomegalovirus infection bacu05164   Influenza A bacu05165   Human papillomavirus infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05168   Herpes simplex virus 1 infection bacu05169   Epstein-Barr virus infection bacu05170   Human immunodeficiency virus 1 infection bacu05171   Coronavirus disease - COVID-19 bacu05200   Pathways in cancer bacu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103009695 (IFNA7)    04151 PI3K-Akt signaling pathway     103009695 (IFNA7)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103009695 (IFNA7)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103009695 (IFNA7)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103009695 (IFNA7)    04621 NOD-like receptor signaling pathway     103009695 (IFNA7)    04622 RIG-I-like receptor signaling pathway     103009695 (IFNA7)    04623 Cytosolic DNA-sensing pathway     103009695 (IFNA7)    04650 Natural killer cell mediated cytotoxicity     103009695 (IFNA7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103009695 (IFNA7)   09163 Immune disease    05320 Autoimmune thyroid disease     103009695 (IFNA7)   09171 Infectious disease: bacterial    05152 Tuberculosis     103009695 (IFNA7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103009695 (IFNA7)    05161 Hepatitis B     103009695 (IFNA7)    05160 Hepatitis C     103009695 (IFNA7)    05171 Coronavirus disease - COVID-19     103009695 (IFNA7)    05164 Influenza A     103009695 (IFNA7)    05162 Measles     103009695 (IFNA7)    05168 Herpes simplex virus 1 infection     103009695 (IFNA7)    05163 Human cytomegalovirus infection     103009695 (IFNA7)    05167 Kaposi sarcoma-associated herpesvirus infection     103009695 (IFNA7)    05169 Epstein-Barr virus infection     103009695 (IFNA7)    05165 Human papillomavirus infection     103009695 (IFNA7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bacu04052]     103009695 (IFNA7) Cytokines and growth factors [BR:bacu04052]  Cytokines   Interferons    103009695 (IFNA7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon LMF1 Motif Other DBs NCBI-GeneID:  103009695 NCBI-ProteinID:  XP_007198436 UniProt:  A0A384BFD6 LinkDB All DBs Position Un AA seq 169 aa AA seqDB search MAQIYLLAAGXLCSIPACPLGWNLPWIHSLQNRELFILLREMKKIPFQSCLXDRTDFKFP WKRGNITEILTTQGTGYHHLMLQQMXNFFNTEESQAAWNNTLLRKLLSSLDHTLELLHKQ VENDNLDCPYFGIVPKYFQRIHLYLKEKEYSPCAWEVIRGEIKVFLSLM NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcccagatctatttgctagcggcaggantactctgctccatccctgcttgccctctt ggctggaacttgccttggatccatagcctacagaacagggaactcttcatacttttgaga gagatgaagaagatcccgtttcagtcatgcctangagacagaaccgacttcaaatttcct tggaaaagagggaatatcacagaaatcctgacgactcaaggcaccggctaccaccatctg atgctccagcagatgngtaacttcttcaacacggaggaaagccaagctgcttggaacaac accctgctccgtaaactactctctagccttgatcacaccttggaactactgcataagcag gtggaaaatgacaatctggattgtccatattttggaattgtcccgaaatatttccaaaga atccatctctatctgaaggaaaaggaatacagcccctgtgcctgggaggttatcagagga gaaattaaagtgttcctttctctcatgtaa

Balaenoptera acutorostrata scammoni (minke whale): 103010469 Help Entry 103010469         CDS       T03086                                  Definition (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04060   Cytokine-cytokine receptor interaction bacu04151   PI3K-Akt signaling pathway bacu04217   Necroptosis bacu04620   Toll-like receptor signaling pathway bacu04621   NOD-like receptor signaling pathway bacu04622   RIG-I-like receptor signaling pathway bacu04623   Cytosolic DNA-sensing pathway bacu04630   JAK-STAT signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu05152   Tuberculosis bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05162   Measles bacu05163   Human cytomegalovirus infection bacu05164   Influenza A bacu05165   Human papillomavirus infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05168   Herpes simplex virus 1 infection bacu05169   Epstein-Barr virus infection bacu05170   Human immunodeficiency virus 1 infection bacu05171   Coronavirus disease - COVID-19 bacu05200   Pathways in cancer bacu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103010469    04151 PI3K-Akt signaling pathway     103010469   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103010469  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103010469  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103010469    04621 NOD-like receptor signaling pathway     103010469    04622 RIG-I-like receptor signaling pathway     103010469    04623 Cytosolic DNA-sensing pathway     103010469    04650 Natural killer cell mediated cytotoxicity     103010469  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103010469   09163 Immune disease    05320 Autoimmune thyroid disease     103010469   09171 Infectious disease: bacterial    05152 Tuberculosis     103010469   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103010469    05161 Hepatitis B     103010469    05160 Hepatitis C     103010469    05171 Coronavirus disease - COVID-19     103010469    05164 Influenza A     103010469    05162 Measles     103010469    05168 Herpes simplex virus 1 infection     103010469    05163 Human cytomegalovirus infection     103010469    05167 Kaposi sarcoma-associated herpesvirus infection     103010469    05169 Epstein-Barr virus infection     103010469    05165 Human papillomavirus infection     103010469  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bacu04052]     103010469 Cytokines and growth factors [BR:bacu04052]  Cytokines   Interferons    103010469 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  103010469 NCBI-ProteinID:  XP_007176880 UniProt:  A0A383ZP45 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MAPTLSFLLALLLLSCNSTCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG FPQEALGDNQFQKAQAIAVVHETTQQTFRLFSTEGSAAAWDETLLDKFCTALSQQLTDLQ ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN LQERLTRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccaaccttgtccttcctcctggccctgctgctgctcagctgcaactccacctgc tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggaggcgcttggagacaaccagttccagaaggctcaagccatcgctgtcgtc catgagacgacccagcagaccttccggctcttcagcacggagggctcggctgccgcttgg gatgagaccctcctggacaagttctgcactgcactttctcagcagctcactgacctgcaa gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaaatacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac ttgcaagaaagactcacgaggaaggaatga

Balaenoptera acutorostrata scammoni (minke whale): 103010766 Help Entry 103010766         CDS       T03086                                  Definition (RefSeq) interferon alpha-1-like   KO K05414   interferon alpha Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04060   Cytokine-cytokine receptor interaction bacu04151   PI3K-Akt signaling pathway bacu04217   Necroptosis bacu04620   Toll-like receptor signaling pathway bacu04621   NOD-like receptor signaling pathway bacu04622   RIG-I-like receptor signaling pathway bacu04623   Cytosolic DNA-sensing pathway bacu04630   JAK-STAT signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu05152   Tuberculosis bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05162   Measles bacu05163   Human cytomegalovirus infection bacu05164   Influenza A bacu05165   Human papillomavirus infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05168   Herpes simplex virus 1 infection bacu05169   Epstein-Barr virus infection bacu05170   Human immunodeficiency virus 1 infection bacu05171   Coronavirus disease - COVID-19 bacu05200   Pathways in cancer bacu05320   Autoimmune thyroid disease Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103010766    04151 PI3K-Akt signaling pathway     103010766   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103010766  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103010766  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103010766    04621 NOD-like receptor signaling pathway     103010766    04622 RIG-I-like receptor signaling pathway     103010766    04623 Cytosolic DNA-sensing pathway     103010766    04650 Natural killer cell mediated cytotoxicity     103010766  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103010766   09163 Immune disease    05320 Autoimmune thyroid disease     103010766   09171 Infectious disease: bacterial    05152 Tuberculosis     103010766   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103010766    05161 Hepatitis B     103010766    05160 Hepatitis C     103010766    05171 Coronavirus disease - COVID-19     103010766    05164 Influenza A     103010766    05162 Measles     103010766    05168 Herpes simplex virus 1 infection     103010766    05163 Human cytomegalovirus infection     103010766    05167 Kaposi sarcoma-associated herpesvirus infection     103010766    05169 Epstein-Barr virus infection     103010766    05165 Human papillomavirus infection     103010766  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:bacu04052]     103010766 Cytokines and growth factors [BR:bacu04052]  Cytokines   Interferons    103010766 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon CBF Motif Other DBs NCBI-GeneID:  103010766 NCBI-ProteinID:  XP_007176881 UniProt:  A0A383ZP54 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MAPTLSFLLALLLLSCNSTCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG FPQEAFGGNQFQKAQAIAVVHETIQQTFQLFSTEGSAAAWDETLLDKFCTALFQQLTDLQ ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN LQERLTRKE NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccaaccttgtccttcctcctggccctgctgctgctcagctgcaactccacctgc tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga ttcccccaggaggcgtttggtggcaaccagttccagaaggctcaagccatcgctgtcgtc catgagacgatccagcagaccttccagctcttcagcacggagggctcggctgccgcttgg gatgagaccctcctggacaagttctgcactgcactttttcagcagctcactgacctgcaa gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaaatacagc ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac ttgcaagaaagactcacgaggaaggaatga

DBGET integrated database retrieval system