KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007162
Entry
103007162         CDS       T03086                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103007162
   04151 PI3K-Akt signaling pathway
    103007162
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103007162
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103007162
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103007162
   04621 NOD-like receptor signaling pathway
    103007162
   04622 RIG-I-like receptor signaling pathway
    103007162
   04623 Cytosolic DNA-sensing pathway
    103007162
   04650 Natural killer cell mediated cytotoxicity
    103007162
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103007162
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103007162
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103007162
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103007162
   05161 Hepatitis B
    103007162
   05160 Hepatitis C
    103007162
   05171 Coronavirus disease - COVID-19
    103007162
   05164 Influenza A
    103007162
   05162 Measles
    103007162
   05168 Herpes simplex virus 1 infection
    103007162
   05163 Human cytomegalovirus infection
    103007162
   05167 Kaposi sarcoma-associated herpesvirus infection
    103007162
   05169 Epstein-Barr virus infection
    103007162
   05165 Human papillomavirus infection
    103007162
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103007162
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interferons
   103007162
SSDB
Motif
Pfam: Interferon CoV_NSP2_N LexA_DNA_bind
Other DBs
NCBI-GeneID: 103007162
NCBI-ProteinID: XP_007198087
UniProt: A0A384BEC7
LinkDB
Position
Un
AA seq 104 aa
PGLRLFSTEGSAAAWDETLLDKFCTALSQQLTDLQACLMQEAGLEGTPLLKEDSILAVRK
YFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTNLQERLRRKE
NT seq 316 nt   +upstreamnt  +downstreamnt
accagggcttcggctcttcagcacggagggctcggctgccgcttgggatgagaccctcct
ggacaagttctgcactgcactttctcagcagctcactgacctgcaagcctgtctgatgca
ggaggcggggctggaagggactcccctgctgaaggaggactccatcctggctgtgaggaa
atacttccacagaatcactgtctatctgcaagagaagaaatacagcccttgtgcctggga
gattgtcagagcagaagtcatgagatccttctcttcatcaacaaacttgcaagaaagact
caggagaaaggaatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008826
Entry
103008826         CDS       T03086                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103008826
   04151 PI3K-Akt signaling pathway
    103008826
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103008826
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103008826
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103008826
   04621 NOD-like receptor signaling pathway
    103008826
   04622 RIG-I-like receptor signaling pathway
    103008826
   04623 Cytosolic DNA-sensing pathway
    103008826
   04650 Natural killer cell mediated cytotoxicity
    103008826
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008826
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103008826
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103008826
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103008826
   05161 Hepatitis B
    103008826
   05160 Hepatitis C
    103008826
   05171 Coronavirus disease - COVID-19
    103008826
   05164 Influenza A
    103008826
   05162 Measles
    103008826
   05168 Herpes simplex virus 1 infection
    103008826
   05163 Human cytomegalovirus infection
    103008826
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008826
   05169 Epstein-Barr virus infection
    103008826
   05165 Human papillomavirus infection
    103008826
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103008826
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interferons
   103008826
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103008826
NCBI-ProteinID: XP_007176876
UniProt: A0A383ZP49
LinkDB
Position
Un
AA seq 189 aa
MAPTLSFLLALLLLSCNSTCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG
FPQEAFGGNQFQKAQAIAVVHETIQQTFRLFSTEGSAAAWDETLLDKFCTALSQQLTDLQ
ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccaaccttgtccttcctcctggccctgctgctgctcagctgcaactccacctgc
tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc
ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga
ttcccccaggaggcgtttggtggcaaccagttccagaaggctcaagccatcgctgtcgtc
catgagacgatccagcagaccttccggctcttcagcacggagggctcggctgccgcttgg
gatgagaccctcctggacaagttctgcactgcactttctcagcagctcactgacctgcaa
gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc
ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaaatacagc
ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac
ttgcaagaaagactcaggaggaaggaatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009695
Entry
103009695         CDS       T03086                                 

Gene name
IFNA7
Definition
(RefSeq) interferon alpha 7
  KO
K05414  interferon alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103009695 (IFNA7)
   04151 PI3K-Akt signaling pathway
    103009695 (IFNA7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103009695 (IFNA7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103009695 (IFNA7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103009695 (IFNA7)
   04621 NOD-like receptor signaling pathway
    103009695 (IFNA7)
   04622 RIG-I-like receptor signaling pathway
    103009695 (IFNA7)
   04623 Cytosolic DNA-sensing pathway
    103009695 (IFNA7)
   04650 Natural killer cell mediated cytotoxicity
    103009695 (IFNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103009695 (IFNA7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103009695 (IFNA7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103009695 (IFNA7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103009695 (IFNA7)
   05161 Hepatitis B
    103009695 (IFNA7)
   05160 Hepatitis C
    103009695 (IFNA7)
   05171 Coronavirus disease - COVID-19
    103009695 (IFNA7)
   05164 Influenza A
    103009695 (IFNA7)
   05162 Measles
    103009695 (IFNA7)
   05168 Herpes simplex virus 1 infection
    103009695 (IFNA7)
   05163 Human cytomegalovirus infection
    103009695 (IFNA7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103009695 (IFNA7)
   05169 Epstein-Barr virus infection
    103009695 (IFNA7)
   05165 Human papillomavirus infection
    103009695 (IFNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103009695 (IFNA7)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interferons
   103009695 (IFNA7)
SSDB
Motif
Pfam: Interferon LMF1
Other DBs
NCBI-GeneID: 103009695
NCBI-ProteinID: XP_007198436
UniProt: A0A384BFD6
LinkDB
Position
Un
AA seq 169 aa
MAQIYLLAAGXLCSIPACPLGWNLPWIHSLQNRELFILLREMKKIPFQSCLXDRTDFKFP
WKRGNITEILTTQGTGYHHLMLQQMXNFFNTEESQAAWNNTLLRKLLSSLDHTLELLHKQ
VENDNLDCPYFGIVPKYFQRIHLYLKEKEYSPCAWEVIRGEIKVFLSLM
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcccagatctatttgctagcggcaggantactctgctccatccctgcttgccctctt
ggctggaacttgccttggatccatagcctacagaacagggaactcttcatacttttgaga
gagatgaagaagatcccgtttcagtcatgcctangagacagaaccgacttcaaatttcct
tggaaaagagggaatatcacagaaatcctgacgactcaaggcaccggctaccaccatctg
atgctccagcagatgngtaacttcttcaacacggaggaaagccaagctgcttggaacaac
accctgctccgtaaactactctctagccttgatcacaccttggaactactgcataagcag
gtggaaaatgacaatctggattgtccatattttggaattgtcccgaaatatttccaaaga
atccatctctatctgaaggaaaaggaatacagcccctgtgcctgggaggttatcagagga
gaaattaaagtgttcctttctctcatgtaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010469
Entry
103010469         CDS       T03086                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103010469
   04151 PI3K-Akt signaling pathway
    103010469
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103010469
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103010469
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103010469
   04621 NOD-like receptor signaling pathway
    103010469
   04622 RIG-I-like receptor signaling pathway
    103010469
   04623 Cytosolic DNA-sensing pathway
    103010469
   04650 Natural killer cell mediated cytotoxicity
    103010469
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010469
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103010469
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103010469
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103010469
   05161 Hepatitis B
    103010469
   05160 Hepatitis C
    103010469
   05171 Coronavirus disease - COVID-19
    103010469
   05164 Influenza A
    103010469
   05162 Measles
    103010469
   05168 Herpes simplex virus 1 infection
    103010469
   05163 Human cytomegalovirus infection
    103010469
   05167 Kaposi sarcoma-associated herpesvirus infection
    103010469
   05169 Epstein-Barr virus infection
    103010469
   05165 Human papillomavirus infection
    103010469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103010469
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interferons
   103010469
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 103010469
NCBI-ProteinID: XP_007176880
UniProt: A0A383ZP45
LinkDB
Position
Un
AA seq 189 aa
MAPTLSFLLALLLLSCNSTCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG
FPQEALGDNQFQKAQAIAVVHETTQQTFRLFSTEGSAAAWDETLLDKFCTALSQQLTDLQ
ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN
LQERLTRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccaaccttgtccttcctcctggccctgctgctgctcagctgcaactccacctgc
tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc
ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga
ttcccccaggaggcgcttggagacaaccagttccagaaggctcaagccatcgctgtcgtc
catgagacgacccagcagaccttccggctcttcagcacggagggctcggctgccgcttgg
gatgagaccctcctggacaagttctgcactgcactttctcagcagctcactgacctgcaa
gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc
ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaaatacagc
ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac
ttgcaagaaagactcacgaggaaggaatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010766
Entry
103010766         CDS       T03086                                 

Definition
(RefSeq) interferon alpha-1-like
  KO
K05414  interferon alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103010766
   04151 PI3K-Akt signaling pathway
    103010766
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103010766
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103010766
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103010766
   04621 NOD-like receptor signaling pathway
    103010766
   04622 RIG-I-like receptor signaling pathway
    103010766
   04623 Cytosolic DNA-sensing pathway
    103010766
   04650 Natural killer cell mediated cytotoxicity
    103010766
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010766
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103010766
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103010766
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103010766
   05161 Hepatitis B
    103010766
   05160 Hepatitis C
    103010766
   05171 Coronavirus disease - COVID-19
    103010766
   05164 Influenza A
    103010766
   05162 Measles
    103010766
   05168 Herpes simplex virus 1 infection
    103010766
   05163 Human cytomegalovirus infection
    103010766
   05167 Kaposi sarcoma-associated herpesvirus infection
    103010766
   05169 Epstein-Barr virus infection
    103010766
   05165 Human papillomavirus infection
    103010766
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103010766
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interferons
   103010766
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 103010766
NCBI-ProteinID: XP_007176881
UniProt: A0A383ZP54
LinkDB
Position
Un
AA seq 189 aa
MAPTLSFLLALLLLSCNSTCSLGCDLPQTHSLANTRALMLLQQMRRISPFSCLKDRNDFG
FPQEAFGGNQFQKAQAIAVVHETIQQTFQLFSTEGSAAAWDETLLDKFCTALFQQLTDLQ
ACLMQEAGLEGTPLLKEDSILAVRKYFHRITVYLQEKKYSPCAWEIVRAEVMRSFSSSTN
LQERLTRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccccaaccttgtccttcctcctggccctgctgctgctcagctgcaactccacctgc
tctctgggctgcgacctgcctcagacccacagcctggctaacacgagggccctgatgctc
ctgcaacaaatgaggagaatctcccccttctcctgcctgaaggacagaaatgactttgga
ttcccccaggaggcgtttggtggcaaccagttccagaaggctcaagccatcgctgtcgtc
catgagacgatccagcagaccttccagctcttcagcacggagggctcggctgccgcttgg
gatgagaccctcctggacaagttctgcactgcactttttcagcagctcactgacctgcaa
gcctgtctgatgcaggaggcggggctggaagggactcccctgctgaaggaggactccatc
ctggctgtgaggaaatacttccacagaatcactgtctatctgcaagagaagaaatacagc
ccttgtgcctgggagattgtcagagcagaagtcatgagatccttctcttcatcaacaaac
ttgcaagaaagactcacgaggaaggaatga

DBGET integrated database retrieval system