KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007242
Entry
103007242         CDS       T03086                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04068  FoxO signaling pathway
bacu05200  Pathways in cancer
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103007242 (STK4)
   04014 Ras signaling pathway
    103007242 (STK4)
   04068 FoxO signaling pathway
    103007242 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103007242 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103007242 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103007242 (STK4)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: STE group
  STE20 family
   103007242 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611
Other DBs
NCBI-GeneID: 103007242
NCBI-ProteinID: XP_007193421
UniProt: A0A384B151
LinkDB
Position
Un
AA seq 494 aa
WAAAGSARETVQLRTPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETG
QIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDI
IRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQ
LTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAI
FMIPTNPPPTFRKPELWSDSFMDFVKQCLIKSPEQRATATQLLQHPFVKSAKGVSILRDL
INEAMDVKLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTISDGANT
MIEHDDTLPSQLGTMVINSEEEEEEGTMKRRDETMQPARPSFLEYFEQKEKENQINSFGK
SVPGPLKNSSDWKVPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPI
LDAIEAKKRRQQNF
NT seq 1485 nt   +upstreamnt  +downstreamnt
tgggcggctgccggcagcgccagggagacggtgcagctcaggaccccgccgcgccggcag
ctgaaaaagttagatgaagatagtttaactaaacaaccagaagaagtgtttgatgtctta
gagaaacttggagaagggtcctatggcagcgtgtacaaagctattcataaagagacaggt
cagattgttgctattaagcaagttcctgtggagtcagacctgcaggagataatcaaagaa
atctctataatgcagcaatgtgacagccctcatgtagtcaaatattatggcagttatttt
aagaacacagacttgtggattgtgatggagtactgtggggctggttctgtgtctgatatc
attcgattacgaaataaaacgttaacagaagatgaaatagctacaatattacagtcaaca
cttaagggactggaataccttcattttatgagaaaaatacaccgagatatcaaggcagga
aatattttgctaaatacagaaggtcatgccaaacttgcagattttggggtagcaggtcaa
cttacagataccatggccaagcgaaatacagtgataggaacaccattttggatggctcca
gaagtgattcaggaaattgggtacaactgtgtggcagacatctggtcgttgggaataaca
gccatagaaatggctgaaggaaaacccccatatgctgatatccatccaatgagggcaatc
ttcatgattcctaccaacccacctcccacattccgaaagccagaactgtggtcagatagc
ttcatggattttgtgaagcagtgtctcataaagagccctgagcagagagccacggccact
caactcctacagcacccatttgtcaagagtgccaaaggagtgtccatactgcgggattta
attaacgaagccatggacgtgaagctgaaacgccaggaagcccagcagcgggaggtggac
caggacgatgaagaaaactcagaggaggatgaaatggattctggcacgatggtccgagca
gcaggggacgagatgggcaccgtccgagtagccagcaccatcagtgatggggccaatact
atgatcgaacacgatgacacattgccatctcagctgggcaccatggtgatcaactcagag
gaggaggaagaggaaggcactatgaaaagaagggatgagaccatgcagcctgcaagacca
tctttccttgaatactttgaacaaaaagaaaaggaaaatcaaatcaacagctttggcaag
agcgtccctggcccactgaagaactcttcagattggaaagttccacaggatggagactat
gagttcctgaagagttggacagtggaagaccttcagaagaggctcttggccctggacccc
atgatggagcaggagattgaagagatccggcagaagtaccagtcgaagcggcagcccatc
cttgatgccattgaggccaagaagcggcggcagcaaaacttctga

DBGET integrated database retrieval system