KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007464
Entry
103007464         CDS       T03086                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05100  Bacterial invasion of epithelial cells
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103007464 (PIK3R1)
   04014 Ras signaling pathway
    103007464 (PIK3R1)
   04015 Rap1 signaling pathway
    103007464 (PIK3R1)
   04370 VEGF signaling pathway
    103007464 (PIK3R1)
   04630 JAK-STAT signaling pathway
    103007464 (PIK3R1)
   04668 TNF signaling pathway
    103007464 (PIK3R1)
   04066 HIF-1 signaling pathway
    103007464 (PIK3R1)
   04068 FoxO signaling pathway
    103007464 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    103007464 (PIK3R1)
   04072 Phospholipase D signaling pathway
    103007464 (PIK3R1)
   04071 Sphingolipid signaling pathway
    103007464 (PIK3R1)
   04024 cAMP signaling pathway
    103007464 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    103007464 (PIK3R1)
   04152 AMPK signaling pathway
    103007464 (PIK3R1)
   04150 mTOR signaling pathway
    103007464 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103007464 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    103007464 (PIK3R1)
   04218 Cellular senescence
    103007464 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103007464 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103007464 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103007464 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103007464 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    103007464 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    103007464 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    103007464 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    103007464 (PIK3R1)
   04660 T cell receptor signaling pathway
    103007464 (PIK3R1)
   04662 B cell receptor signaling pathway
    103007464 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    103007464 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    103007464 (PIK3R1)
   04670 Leukocyte transendothelial migration
    103007464 (PIK3R1)
   04062 Chemokine signaling pathway
    103007464 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103007464 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    103007464 (PIK3R1)
   04929 GnRH secretion
    103007464 (PIK3R1)
   04915 Estrogen signaling pathway
    103007464 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    103007464 (PIK3R1)
   04917 Prolactin signaling pathway
    103007464 (PIK3R1)
   04926 Relaxin signaling pathway
    103007464 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    103007464 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    103007464 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103007464 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103007464 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    103007464 (PIK3R1)
   04722 Neurotrophin signaling pathway
    103007464 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103007464 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    103007464 (PIK3R1)
   04380 Osteoclast differentiation
    103007464 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    103007464 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    103007464 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103007464 (PIK3R1)
   05206 MicroRNAs in cancer
    103007464 (PIK3R1)
   05205 Proteoglycans in cancer
    103007464 (PIK3R1)
   05203 Viral carcinogenesis
    103007464 (PIK3R1)
   05230 Central carbon metabolism in cancer
    103007464 (PIK3R1)
   05231 Choline metabolism in cancer
    103007464 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103007464 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103007464 (PIK3R1)
   05212 Pancreatic cancer
    103007464 (PIK3R1)
   05225 Hepatocellular carcinoma
    103007464 (PIK3R1)
   05226 Gastric cancer
    103007464 (PIK3R1)
   05214 Glioma
    103007464 (PIK3R1)
   05221 Acute myeloid leukemia
    103007464 (PIK3R1)
   05220 Chronic myeloid leukemia
    103007464 (PIK3R1)
   05218 Melanoma
    103007464 (PIK3R1)
   05211 Renal cell carcinoma
    103007464 (PIK3R1)
   05215 Prostate cancer
    103007464 (PIK3R1)
   05213 Endometrial cancer
    103007464 (PIK3R1)
   05224 Breast cancer
    103007464 (PIK3R1)
   05222 Small cell lung cancer
    103007464 (PIK3R1)
   05223 Non-small cell lung cancer
    103007464 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103007464 (PIK3R1)
   05017 Spinocerebellar ataxia
    103007464 (PIK3R1)
   05020 Prion disease
    103007464 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103007464 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103007464 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    103007464 (PIK3R1)
   04931 Insulin resistance
    103007464 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103007464 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103007464 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    103007464 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103007464 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    103007464 (PIK3R1)
   05161 Hepatitis B
    103007464 (PIK3R1)
   05160 Hepatitis C
    103007464 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    103007464 (PIK3R1)
   05164 Influenza A
    103007464 (PIK3R1)
   05162 Measles
    103007464 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    103007464 (PIK3R1)
   05163 Human cytomegalovirus infection
    103007464 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103007464 (PIK3R1)
   05169 Epstein-Barr virus infection
    103007464 (PIK3R1)
   05165 Human papillomavirus infection
    103007464 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103007464 (PIK3R1)
   05142 Chagas disease
    103007464 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103007464 (PIK3R1)
   01524 Platinum drug resistance
    103007464 (PIK3R1)
   01522 Endocrine resistance
    103007464 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103007464 (PIK3R1)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103007464 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 SH3_2 DUF4201 Laminin_I Lant_dehydr_C PI_PP_I Mod_r
Other DBs
NCBI-GeneID: 103007464
NCBI-ProteinID: XP_007176054
UniProt: A0A383ZMD9
LinkDB
Position
Un
AA seq 724 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADSEQQASTLPDLAE
QFAPPDVAPLLLIKLVEAIEKKGLECPTLYRTQSSSNPAELRQLLDCDAASVDLEMIDVH
VLADAFKRYLLDLPNPVIPVAIYNEMVSLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKVTEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgccgaggggtaccagtacagggcgctgtacgactataaaaaggagcgggaagaa
gacattgacttgcacttgggggacgtactgactgtgaataaagggtccttagtagctctt
ggattcagtgatggacaagaagccaggcctgaagaaatcggctggttaaatggctataac
gagaccacgggggagaggggggactttccgggaacttacgtagaatacattggaaggaaa
aagatctcaccgcccacaccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttcaaaaactgaagcagacagtgagcaacaagcttcgactcttccagaccttgcagag
cagttcgcccctcctgacgttgctccactgcttcttatcaagctagtggaagccattgaa
aagaaaggtctggaatgtccaactctatacagaacacagagctccagcaacccagcagaa
ttacgacagctccttgattgtgatgctgcctccgtggacttggaaatgatcgatgtgcac
gtcttagcagacgctttcaaacgctatctcctggacttaccaaatcctgtcattccagta
gccatctacaatgaaatggtttctttagccccagaagtgcaaagctctgaagaatacatc
cagctgttgaagaagctcattaggtcgcccagcatacctcatcagtattggctcacgctg
cagtatttgctaaaacatttcttcaagctctctcaaacgtccagcaaaaatcttttgaat
gcaagagtactctctgaactcttcagccccctgcttttcagattcccagcagccagttct
gagaatactgaacacctcataaaagttacggaaattttaatctccaccgaatggaatgaa
cgccagcctgcaccagcactgcctcctaaaccaccaaaacccacgactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatttcgagg
gaagaagtgaatgaaaaacttcgagatacagctgatgggacctttttggtacgagacgca
tctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaactct
gtggttgaactaataaaccactaccggaatgaatctctagctcagtataatcccaaactg
gatgtgaaattactttatccagtatccaaataccaacaggatcaggttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataacactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaagattatacccgtacttcccaggaaatccaaatgaaa
agaacagctattgaagcatttaatgaaaccataaagatatttgaagaacagtgccaaacc
caggagcggtacagcaaagaatacatagaaaagtttaaacgtgaaggcaatgagaaggaa
atccaaaggattatgcataattatgaaaagttaaagtctcgaatcagtgaaattgtcgac
agcagaaggagactggaggaggacttgaagaagcaggctgccgagtatcgtgagattgac
aagcggatgaacagcattaaaccagacctcattcaactgagaaagacaagagaccaatac
ttgatgtggttgactcagaaaggtgttcggcagaagaagctgaacgagtggctgggcaat
gaaaacactgaagaccaatattcgctggtggaagatgatgaggatttgccccaccatgac
gagaagacgtggaatgttggaagcagcaaccgaaacaaagccgaaaacctgttgcgaggg
aaacgagatggcacttttcttgtccgggaaagcagtaaacagggctgctacgcgtgctcc
gtagtggtggacggtgaggtcaagcactgcgtcatcaacaagacggccacgggctacggc
ttcgccgagccctacaacctgtacagctccctgaaggaactggtgctccactaccaacac
acgtccctcgtgcagcacaacgactccctcaacgtcacactagcctacccggtgtacgcg
cagcagcggcgatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008077
Entry
103008077         CDS       T03086                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05100  Bacterial invasion of epithelial cells
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103008077 (PIK3R3)
   04014 Ras signaling pathway
    103008077 (PIK3R3)
   04015 Rap1 signaling pathway
    103008077 (PIK3R3)
   04370 VEGF signaling pathway
    103008077 (PIK3R3)
   04630 JAK-STAT signaling pathway
    103008077 (PIK3R3)
   04668 TNF signaling pathway
    103008077 (PIK3R3)
   04066 HIF-1 signaling pathway
    103008077 (PIK3R3)
   04068 FoxO signaling pathway
    103008077 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    103008077 (PIK3R3)
   04072 Phospholipase D signaling pathway
    103008077 (PIK3R3)
   04071 Sphingolipid signaling pathway
    103008077 (PIK3R3)
   04024 cAMP signaling pathway
    103008077 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    103008077 (PIK3R3)
   04152 AMPK signaling pathway
    103008077 (PIK3R3)
   04150 mTOR signaling pathway
    103008077 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103008077 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    103008077 (PIK3R3)
   04218 Cellular senescence
    103008077 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103008077 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103008077 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103008077 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103008077 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    103008077 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    103008077 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    103008077 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    103008077 (PIK3R3)
   04660 T cell receptor signaling pathway
    103008077 (PIK3R3)
   04662 B cell receptor signaling pathway
    103008077 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    103008077 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    103008077 (PIK3R3)
   04670 Leukocyte transendothelial migration
    103008077 (PIK3R3)
   04062 Chemokine signaling pathway
    103008077 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103008077 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    103008077 (PIK3R3)
   04929 GnRH secretion
    103008077 (PIK3R3)
   04915 Estrogen signaling pathway
    103008077 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    103008077 (PIK3R3)
   04917 Prolactin signaling pathway
    103008077 (PIK3R3)
   04926 Relaxin signaling pathway
    103008077 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    103008077 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    103008077 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103008077 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103008077 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    103008077 (PIK3R3)
   04722 Neurotrophin signaling pathway
    103008077 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103008077 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    103008077 (PIK3R3)
   04380 Osteoclast differentiation
    103008077 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    103008077 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    103008077 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008077 (PIK3R3)
   05206 MicroRNAs in cancer
    103008077 (PIK3R3)
   05205 Proteoglycans in cancer
    103008077 (PIK3R3)
   05203 Viral carcinogenesis
    103008077 (PIK3R3)
   05230 Central carbon metabolism in cancer
    103008077 (PIK3R3)
   05231 Choline metabolism in cancer
    103008077 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103008077 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103008077 (PIK3R3)
   05212 Pancreatic cancer
    103008077 (PIK3R3)
   05225 Hepatocellular carcinoma
    103008077 (PIK3R3)
   05226 Gastric cancer
    103008077 (PIK3R3)
   05214 Glioma
    103008077 (PIK3R3)
   05221 Acute myeloid leukemia
    103008077 (PIK3R3)
   05220 Chronic myeloid leukemia
    103008077 (PIK3R3)
   05218 Melanoma
    103008077 (PIK3R3)
   05211 Renal cell carcinoma
    103008077 (PIK3R3)
   05215 Prostate cancer
    103008077 (PIK3R3)
   05213 Endometrial cancer
    103008077 (PIK3R3)
   05224 Breast cancer
    103008077 (PIK3R3)
   05222 Small cell lung cancer
    103008077 (PIK3R3)
   05223 Non-small cell lung cancer
    103008077 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103008077 (PIK3R3)
   05017 Spinocerebellar ataxia
    103008077 (PIK3R3)
   05020 Prion disease
    103008077 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103008077 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103008077 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    103008077 (PIK3R3)
   04931 Insulin resistance
    103008077 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103008077 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103008077 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    103008077 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103008077 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    103008077 (PIK3R3)
   05161 Hepatitis B
    103008077 (PIK3R3)
   05160 Hepatitis C
    103008077 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    103008077 (PIK3R3)
   05164 Influenza A
    103008077 (PIK3R3)
   05162 Measles
    103008077 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    103008077 (PIK3R3)
   05163 Human cytomegalovirus infection
    103008077 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008077 (PIK3R3)
   05169 Epstein-Barr virus infection
    103008077 (PIK3R3)
   05165 Human papillomavirus infection
    103008077 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103008077 (PIK3R3)
   05142 Chagas disease
    103008077 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103008077 (PIK3R3)
   01524 Platinum drug resistance
    103008077 (PIK3R3)
   01522 Endocrine resistance
    103008077 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103008077 (PIK3R3)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103008077 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Cupin_8 Fez1 DUF5638
Other DBs
NCBI-GeneID: 103008077
NCBI-ProteinID: XP_007164591
LinkDB
Position
Un
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGMKDGSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRKEGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDAAETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccaccgaagccaatgacttcagccattacaaatggaatgaaggacggttctgtttctctt
caggatgcagaatggtactggggagatatttcaagggaggaggtaaatgacaaattacgg
gacatgccagatggtaccttcttggtcagagatgcctcaacaaaaatgcagggagattac
actttgactttgcggaagggaggcaataataagctaataaagatctatcatcgagatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattagccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataacattgatgcagtaggtaaaaaa
ctgcaagagtatcactctcagtatcaggaaaagagtaaagagtatgacaggctatatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcatacacaagagcaacatagcaaagaatat
attgagcgatttcggaaagaagggaatgaaaaggaaattgaacgaattatgatgaactat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtgtggctcaatcacaaagga
gtaagacagaagcgcctaaatgcctggctgggaatcaagaatgaggatgctgctgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgaaaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattc
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgctgatggggaa
gtgaagcactgcgtgatctacagcactgctcggggctatggctttgccgagccctacaac
ctgtacagctcactgaaggagctggtgctccattaccagcagacatccctcgtccagcac
aatgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcgctctgc
agataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009307
Entry
103009307         CDS       T03086                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05100  Bacterial invasion of epithelial cells
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103009307 (PIK3R2)
   04014 Ras signaling pathway
    103009307 (PIK3R2)
   04015 Rap1 signaling pathway
    103009307 (PIK3R2)
   04370 VEGF signaling pathway
    103009307 (PIK3R2)
   04630 JAK-STAT signaling pathway
    103009307 (PIK3R2)
   04668 TNF signaling pathway
    103009307 (PIK3R2)
   04066 HIF-1 signaling pathway
    103009307 (PIK3R2)
   04068 FoxO signaling pathway
    103009307 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    103009307 (PIK3R2)
   04072 Phospholipase D signaling pathway
    103009307 (PIK3R2)
   04071 Sphingolipid signaling pathway
    103009307 (PIK3R2)
   04024 cAMP signaling pathway
    103009307 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    103009307 (PIK3R2)
   04152 AMPK signaling pathway
    103009307 (PIK3R2)
   04150 mTOR signaling pathway
    103009307 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103009307 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    103009307 (PIK3R2)
   04218 Cellular senescence
    103009307 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103009307 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103009307 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103009307 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103009307 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    103009307 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    103009307 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    103009307 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    103009307 (PIK3R2)
   04660 T cell receptor signaling pathway
    103009307 (PIK3R2)
   04662 B cell receptor signaling pathway
    103009307 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    103009307 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    103009307 (PIK3R2)
   04670 Leukocyte transendothelial migration
    103009307 (PIK3R2)
   04062 Chemokine signaling pathway
    103009307 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103009307 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    103009307 (PIK3R2)
   04929 GnRH secretion
    103009307 (PIK3R2)
   04915 Estrogen signaling pathway
    103009307 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    103009307 (PIK3R2)
   04917 Prolactin signaling pathway
    103009307 (PIK3R2)
   04926 Relaxin signaling pathway
    103009307 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    103009307 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    103009307 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103009307 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103009307 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    103009307 (PIK3R2)
   04722 Neurotrophin signaling pathway
    103009307 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103009307 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    103009307 (PIK3R2)
   04380 Osteoclast differentiation
    103009307 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    103009307 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    103009307 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103009307 (PIK3R2)
   05206 MicroRNAs in cancer
    103009307 (PIK3R2)
   05205 Proteoglycans in cancer
    103009307 (PIK3R2)
   05203 Viral carcinogenesis
    103009307 (PIK3R2)
   05230 Central carbon metabolism in cancer
    103009307 (PIK3R2)
   05231 Choline metabolism in cancer
    103009307 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103009307 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103009307 (PIK3R2)
   05212 Pancreatic cancer
    103009307 (PIK3R2)
   05225 Hepatocellular carcinoma
    103009307 (PIK3R2)
   05226 Gastric cancer
    103009307 (PIK3R2)
   05214 Glioma
    103009307 (PIK3R2)
   05221 Acute myeloid leukemia
    103009307 (PIK3R2)
   05220 Chronic myeloid leukemia
    103009307 (PIK3R2)
   05218 Melanoma
    103009307 (PIK3R2)
   05211 Renal cell carcinoma
    103009307 (PIK3R2)
   05215 Prostate cancer
    103009307 (PIK3R2)
   05213 Endometrial cancer
    103009307 (PIK3R2)
   05224 Breast cancer
    103009307 (PIK3R2)
   05222 Small cell lung cancer
    103009307 (PIK3R2)
   05223 Non-small cell lung cancer
    103009307 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103009307 (PIK3R2)
   05017 Spinocerebellar ataxia
    103009307 (PIK3R2)
   05020 Prion disease
    103009307 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103009307 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103009307 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    103009307 (PIK3R2)
   04931 Insulin resistance
    103009307 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103009307 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103009307 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    103009307 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103009307 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    103009307 (PIK3R2)
   05161 Hepatitis B
    103009307 (PIK3R2)
   05160 Hepatitis C
    103009307 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    103009307 (PIK3R2)
   05164 Influenza A
    103009307 (PIK3R2)
   05162 Measles
    103009307 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    103009307 (PIK3R2)
   05163 Human cytomegalovirus infection
    103009307 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103009307 (PIK3R2)
   05169 Epstein-Barr virus infection
    103009307 (PIK3R2)
   05165 Human papillomavirus infection
    103009307 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103009307 (PIK3R2)
   05142 Chagas disease
    103009307 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103009307 (PIK3R2)
   01524 Platinum drug resistance
    103009307 (PIK3R2)
   01522 Endocrine resistance
    103009307 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103009307 (PIK3R2)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103009307 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH3_1 SH3_9 RhoGAP ATG11 Ribosomal_L22e Tai4
Other DBs
NCBI-GeneID: 103009307
NCBI-ProteinID: XP_007195681
UniProt: A0A384B7J3
LinkDB
Position
Un
AA seq 700 aa
MAGAEGFQYRALYPFCRERPEDLELLPGDVLVVSRAALQALGVAEGSERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVTLARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAVERTGLDSYRPEAPAARTDWSLSDMEQWDAAALTDGVKGFLLALPA
PLVTPEAAAEAHRALREAAGPPASPTLLPLTCFHIDPPPDAQAHAGPCAHQALPSAHHTS
LPRRTEATPDFPALLVEKLLQEHLEEQEIAPPALPPKPPKAKPAPTGLVNGGNPPSLQDA
EWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYG
FSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKV
YHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLER
FRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQASDNREIDKRMNSLKPDLM
QLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYSLMEDEDDLPHHEERTWYVGKIN
RTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGS
LKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPATR
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggctggcgccgagggcttccagtaccgtgcgttgtacccgttctgccgggagcggccg
gaggacctggagctgctgccgggcgacgtgctggtggtgagcagggcagccctgcaggcg
ctgggcgtggccgagggcagcgagcgctgcccacagagcgtgggctggatgcctggcctc
aatgagcgtacacggcagcgcggcgacttccctggcacctatgttgagttcctaggacct
gtgaccctggcccggcctgggcctcgcccacgtggcccacgcccactgcctgccaggccc
cgagatgggccccctgagccaggcctcacactccctgacctacccgagcagttctccccg
cctgacgtggctccccctatcctggtgaaacttgtggaggccgttgagcggacagggcta
gacagctacaggcctgaggcacctgccgcgcgcacagactggtcgctgagcgatatggag
cagtgggacgctgcagccctgactgatggcgtgaagggcttcctgctggcgctgcccgca
ccccttgtgacacccgaggccgcggctgaggcacaccgagccctgcgggaggccgcgggg
ccccctgcgtcacctactcttcttcccctcacatgctttcacatagaccccccgccagac
gcgcaagcacatgcagggccctgtgcacaccaggccctacccagcgctcaccacacgtcc
cttccccgtaggactgaggctacccccgacttccctgcgctactggtggagaagttgctt
caggaacatctggaggaacaggagattgcgcccccagcactgccaccaaaaccccccaag
gcaaagccagcccccacaggcctggtcaatgggggcaacccgccctccctgcaggatgct
gagtggtactggggtgacatctccagggaggaggtaaacgagaaactgcgggacacacct
gatggcacctttctggtccgagatgcatctagcaagatccagggggagtacacgctgacc
ctcaggaaaggtggaaacaacaagctgatcaaggtcttccaccgagacgggcactatggc
ttttcagagccactcaccttctgctctgttgtggacctcatcacccactaccgccacgag
tcgctggctcagtacaacgccaagctggacacgcgactcctctacccggtgtccaagtac
cagcaggaccagatcgtcaaggaggatagtgtggaagcagtgggcgcccagctcaaggtc
taccaccagcagtaccaggacaagagccgcgagtatgaccagctctacgaggagtacaca
cgcacctcccaggaactgcagatgaagcgcacagccatcgaggccttcaatgagactatc
aagatctttgaagagcagggccagacacaggagaagtgcagcaaggagtatctggagcgc
ttccggcgtgagggcaatgagaaagagatgcagaggatcctgctgaactcagagcgactt
aagtctcgcattgctgagatccacgagagccgcacaaagctggaacaggagctgcgggca
caggcctccgacaaccgagagattgacaagcgcatgaacagcctcaagccagacctcatg
cagctgcgcaagattagagaccagtacctcgtgtggctcactcagaaaggtgcccggcag
aagaaaatcaatgaatggttggggatcaagaacgagactgaggaccagtactcactgatg
gaggatgaagatgatctcccccaccatgaggaacgcacgtggtatgtaggcaagatcaac
cgcacccaagctgaggaaatgctgagcggcaagcgggatggcaccttcctcatccgtgaa
agcagccagcggggctgctatgcctgttctgtggtggtggacggcgacaccaagcactgc
gtcatctaccgcactgccacgggctttggctttgcagaaccctacaacttgtacgggtca
ctgaaggagctggtgctgcactaccagcacgcctcgctggtgcagcacaacgacgcgctc
actgtcacgcttgcccatcctgtgcgcgccccgggccccgggcccccacctgccacccgc
tga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012691
Entry
103012691         CDS       T03086                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103012691 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103012691 (PIK3CA)
   04014 Ras signaling pathway
    103012691 (PIK3CA)
   04015 Rap1 signaling pathway
    103012691 (PIK3CA)
   04370 VEGF signaling pathway
    103012691 (PIK3CA)
   04630 JAK-STAT signaling pathway
    103012691 (PIK3CA)
   04668 TNF signaling pathway
    103012691 (PIK3CA)
   04066 HIF-1 signaling pathway
    103012691 (PIK3CA)
   04068 FoxO signaling pathway
    103012691 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    103012691 (PIK3CA)
   04072 Phospholipase D signaling pathway
    103012691 (PIK3CA)
   04071 Sphingolipid signaling pathway
    103012691 (PIK3CA)
   04024 cAMP signaling pathway
    103012691 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    103012691 (PIK3CA)
   04152 AMPK signaling pathway
    103012691 (PIK3CA)
   04150 mTOR signaling pathway
    103012691 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103012691 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    103012691 (PIK3CA)
   04218 Cellular senescence
    103012691 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103012691 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    103012691 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103012691 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103012691 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    103012691 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    103012691 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    103012691 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    103012691 (PIK3CA)
   04660 T cell receptor signaling pathway
    103012691 (PIK3CA)
   04662 B cell receptor signaling pathway
    103012691 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    103012691 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    103012691 (PIK3CA)
   04670 Leukocyte transendothelial migration
    103012691 (PIK3CA)
   04062 Chemokine signaling pathway
    103012691 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103012691 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    103012691 (PIK3CA)
   04929 GnRH secretion
    103012691 (PIK3CA)
   04915 Estrogen signaling pathway
    103012691 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    103012691 (PIK3CA)
   04917 Prolactin signaling pathway
    103012691 (PIK3CA)
   04926 Relaxin signaling pathway
    103012691 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    103012691 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    103012691 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103012691 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103012691 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    103012691 (PIK3CA)
   04722 Neurotrophin signaling pathway
    103012691 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103012691 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    103012691 (PIK3CA)
   04380 Osteoclast differentiation
    103012691 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    103012691 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    103012691 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012691 (PIK3CA)
   05206 MicroRNAs in cancer
    103012691 (PIK3CA)
   05205 Proteoglycans in cancer
    103012691 (PIK3CA)
   05203 Viral carcinogenesis
    103012691 (PIK3CA)
   05230 Central carbon metabolism in cancer
    103012691 (PIK3CA)
   05231 Choline metabolism in cancer
    103012691 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103012691 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103012691 (PIK3CA)
   05212 Pancreatic cancer
    103012691 (PIK3CA)
   05225 Hepatocellular carcinoma
    103012691 (PIK3CA)
   05226 Gastric cancer
    103012691 (PIK3CA)
   05214 Glioma
    103012691 (PIK3CA)
   05221 Acute myeloid leukemia
    103012691 (PIK3CA)
   05220 Chronic myeloid leukemia
    103012691 (PIK3CA)
   05218 Melanoma
    103012691 (PIK3CA)
   05211 Renal cell carcinoma
    103012691 (PIK3CA)
   05215 Prostate cancer
    103012691 (PIK3CA)
   05213 Endometrial cancer
    103012691 (PIK3CA)
   05224 Breast cancer
    103012691 (PIK3CA)
   05222 Small cell lung cancer
    103012691 (PIK3CA)
   05223 Non-small cell lung cancer
    103012691 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103012691 (PIK3CA)
   05017 Spinocerebellar ataxia
    103012691 (PIK3CA)
   05020 Prion disease
    103012691 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103012691 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103012691 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    103012691 (PIK3CA)
   04931 Insulin resistance
    103012691 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103012691 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103012691 (PIK3CA)
   05135 Yersinia infection
    103012691 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    103012691 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103012691 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    103012691 (PIK3CA)
   05161 Hepatitis B
    103012691 (PIK3CA)
   05160 Hepatitis C
    103012691 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    103012691 (PIK3CA)
   05164 Influenza A
    103012691 (PIK3CA)
   05162 Measles
    103012691 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    103012691 (PIK3CA)
   05163 Human cytomegalovirus infection
    103012691 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103012691 (PIK3CA)
   05169 Epstein-Barr virus infection
    103012691 (PIK3CA)
   05165 Human papillomavirus infection
    103012691 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103012691 (PIK3CA)
   05142 Chagas disease
    103012691 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103012691 (PIK3CA)
   01524 Platinum drug resistance
    103012691 (PIK3CA)
   01522 Endocrine resistance
    103012691 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103012691 (PIK3CA)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103012691 (PIK3CA)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103012691 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 103012691
NCBI-ProteinID: XP_007198799
UniProt: A0A384BHM3
LinkDB
Position
Un
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFXRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRQGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
GSVVKFPDMSVIEEHANWSVSREAGFSYSYAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcgagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtgtgtgaattcgatatggttaaagatccagaagtacaggactttnga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatctcaattcaccgcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgacgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctaatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcacttagaataaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgacaagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttctatttgttctgttaaaggccgacagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
ggcagtgtggtgaagtttccagatatgtcagtgattgaagagcatgccaattggtctgta
tcccgagaagcaggatttagttattcctatgcaggactgagtaacagactagctagagat
aacgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctctg
tctgaaatcactgagcaagagaaggattttctgtggagccatagacactattgtgtaact
atccctgaaattctacccaaattgcttctgtctgttaaatggaattctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcgatgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtcctaaaa
tatgaacagtatttggataacctacttgtgaggtttttactcaaaaaagcattgactaat
caaaggattgggcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatttgaag
cacctgaataggcaggttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaaatttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacagggctttctatcgcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacacttcaaattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtcc
attggtgactgtgtgggacttattgaggtggtgagaaattctcacactattatgcaaatt
cagtgtaaaggaggcctgaaaggtgccctgcagttcaacagccacacactacatcagtgg
ctcaaagacaagaacaagggagaaatatatgatgcagccatcgatctatttacacgttca
tgtgctggatattgtgttgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggatcac
aagaagaaaaaattcggttataaacgagagcgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaggaggctttggaatatttcatg
aaacaaatgaatgatgcacaccatggtggctggacgacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012931
Entry
103012931         CDS       T03086                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103012931 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103012931 (PIK3CB)
   04014 Ras signaling pathway
    103012931 (PIK3CB)
   04015 Rap1 signaling pathway
    103012931 (PIK3CB)
   04370 VEGF signaling pathway
    103012931 (PIK3CB)
   04630 JAK-STAT signaling pathway
    103012931 (PIK3CB)
   04668 TNF signaling pathway
    103012931 (PIK3CB)
   04066 HIF-1 signaling pathway
    103012931 (PIK3CB)
   04068 FoxO signaling pathway
    103012931 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    103012931 (PIK3CB)
   04072 Phospholipase D signaling pathway
    103012931 (PIK3CB)
   04071 Sphingolipid signaling pathway
    103012931 (PIK3CB)
   04024 cAMP signaling pathway
    103012931 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    103012931 (PIK3CB)
   04152 AMPK signaling pathway
    103012931 (PIK3CB)
   04150 mTOR signaling pathway
    103012931 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103012931 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    103012931 (PIK3CB)
   04218 Cellular senescence
    103012931 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103012931 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    103012931 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103012931 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103012931 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    103012931 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    103012931 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    103012931 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    103012931 (PIK3CB)
   04660 T cell receptor signaling pathway
    103012931 (PIK3CB)
   04662 B cell receptor signaling pathway
    103012931 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    103012931 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    103012931 (PIK3CB)
   04670 Leukocyte transendothelial migration
    103012931 (PIK3CB)
   04062 Chemokine signaling pathway
    103012931 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103012931 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    103012931 (PIK3CB)
   04929 GnRH secretion
    103012931 (PIK3CB)
   04915 Estrogen signaling pathway
    103012931 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    103012931 (PIK3CB)
   04917 Prolactin signaling pathway
    103012931 (PIK3CB)
   04926 Relaxin signaling pathway
    103012931 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    103012931 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    103012931 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103012931 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103012931 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    103012931 (PIK3CB)
   04722 Neurotrophin signaling pathway
    103012931 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103012931 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    103012931 (PIK3CB)
   04380 Osteoclast differentiation
    103012931 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    103012931 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    103012931 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012931 (PIK3CB)
   05206 MicroRNAs in cancer
    103012931 (PIK3CB)
   05205 Proteoglycans in cancer
    103012931 (PIK3CB)
   05203 Viral carcinogenesis
    103012931 (PIK3CB)
   05230 Central carbon metabolism in cancer
    103012931 (PIK3CB)
   05231 Choline metabolism in cancer
    103012931 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103012931 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103012931 (PIK3CB)
   05212 Pancreatic cancer
    103012931 (PIK3CB)
   05225 Hepatocellular carcinoma
    103012931 (PIK3CB)
   05226 Gastric cancer
    103012931 (PIK3CB)
   05214 Glioma
    103012931 (PIK3CB)
   05221 Acute myeloid leukemia
    103012931 (PIK3CB)
   05220 Chronic myeloid leukemia
    103012931 (PIK3CB)
   05218 Melanoma
    103012931 (PIK3CB)
   05211 Renal cell carcinoma
    103012931 (PIK3CB)
   05215 Prostate cancer
    103012931 (PIK3CB)
   05213 Endometrial cancer
    103012931 (PIK3CB)
   05224 Breast cancer
    103012931 (PIK3CB)
   05222 Small cell lung cancer
    103012931 (PIK3CB)
   05223 Non-small cell lung cancer
    103012931 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103012931 (PIK3CB)
   05017 Spinocerebellar ataxia
    103012931 (PIK3CB)
   05020 Prion disease
    103012931 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103012931 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103012931 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    103012931 (PIK3CB)
   04931 Insulin resistance
    103012931 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103012931 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103012931 (PIK3CB)
   05135 Yersinia infection
    103012931 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    103012931 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103012931 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    103012931 (PIK3CB)
   05161 Hepatitis B
    103012931 (PIK3CB)
   05160 Hepatitis C
    103012931 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    103012931 (PIK3CB)
   05164 Influenza A
    103012931 (PIK3CB)
   05162 Measles
    103012931 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    103012931 (PIK3CB)
   05163 Human cytomegalovirus infection
    103012931 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103012931 (PIK3CB)
   05169 Epstein-Barr virus infection
    103012931 (PIK3CB)
   05165 Human papillomavirus infection
    103012931 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103012931 (PIK3CB)
   05142 Chagas disease
    103012931 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103012931 (PIK3CB)
   01524 Platinum drug resistance
    103012931 (PIK3CB)
   01522 Endocrine resistance
    103012931 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103012931 (PIK3CB)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103012931 (PIK3CB)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103012931 (PIK3CB)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 103012931
NCBI-ProteinID: XP_007170382
UniProt: A0A383Z5Q4
LinkDB
Position
Un
AA seq 1070 aa
MCFRFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISYIKQMLW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKHTYPPEH
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKLYEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKAI
NPSKYQTIRKSGKVDYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIRFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRXXXXXPAVSVQFGVILEAYCRGSVGHMKALSKQVDALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYIEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDHSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttccgcttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagatagcatctgatggctccatacccgtggatttccttttgcccactgggatt
tatatccagctggaggtacctcgggaagctaccatttcctatattaaacagatgttatgg
aaacaagttcataattacccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gacgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaggtgaatgaattccgaataaaaatgcgcagattcagtgaggaaaagatt
cagtcgcttgtgggattgtcttggatggattggctaaagcacacctatccaccagagcat
gaaccatccattcctgaaaatttagaagataaactttacggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagctttcaagtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtttgactattcatgggaaagaagatgaa
gttagcccctatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cacccactaattcagttccagtatatccggaactgtgtaatgaatagagccttgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaattcatctaaccttcctcttcctttaccaccaaagaaaact
cgaattatttctcatgtttgggaaaataacaaccctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggctggcctttttcatggt
accgaactcctgtgtaaaaccgttgtaagctcagagatatcagggaaaaatgatcatatt
tggaatgaaccactggaatttgatatcaatacttgtgacctgccacgaatggctcgatta
tgtttcgctgtttatgcagttttggataaagtgaaaacgaagaaatcaactaaagctatt
aatccctctaaatatcagaccatcaggaaatctggaaaagtggattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagatataatattgcac
agctggtcttcatttcctgatgagcttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcacatcagattcccagagaataaaaaa
caaccttattactatcctccctttgataagattattgaaaaggcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactgaaagaa
atcttggacagggatcccttgtctcaactgtgtgagaatgaaatggatcttatttggacg
ttgcgacaagactgcagagagaatttcccacagtcattgccaaaattactgctgtcaatc
aagtggaataaacttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccctggagcttctagatttcaactatccagatcagtacgtgcga
gaatatgctgtgggctgtctgcaacagatgagtgatgaagaactctctcaatatcttcta
cagttggtgcaagttttaaaatatgagccttttcttgattgtgccctctctagattccta
ctagaaagagcacttgctaatcggaggatagggcagtttttattttggcaccttaggtnn
nnnnnnnnnnttcctgctgtttcagtacaatttggtgtcatccttgaagcttactgccgg
ggaagcgtaggtcacatgaaagcgctttccaagcaggttgacgcactcaataaattaaaa
actttaaatagtttaatcaaactgaatgcaatgaagctaaatagagccaaagggaaagaa
gcaatgcacacttgtttaaaacagaatgcttatcgggaagccctctctgacctgcaatca
cctctgaacccatgtgttatcctctcagaactctatattgagaagtgtaaatacatggat
tccaaaatgaagcctttgtggctggtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactctggaaagaagctggtctggatcttaggatgctgccttatggc
tgtttagcaacaggagaccactctggcctcattgaagttgtgagcacctctgagacaatt
gctgatattcagctgaacagtagcaatgtggctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagagagtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacggagaagtttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgacggcatgggaatctcttc
atcactctctttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014043
Entry
103014043         CDS       T03086                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05020  Prion disease
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103014043 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103014043 (PIK3CD)
   04014 Ras signaling pathway
    103014043 (PIK3CD)
   04015 Rap1 signaling pathway
    103014043 (PIK3CD)
   04370 VEGF signaling pathway
    103014043 (PIK3CD)
   04630 JAK-STAT signaling pathway
    103014043 (PIK3CD)
   04668 TNF signaling pathway
    103014043 (PIK3CD)
   04066 HIF-1 signaling pathway
    103014043 (PIK3CD)
   04068 FoxO signaling pathway
    103014043 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    103014043 (PIK3CD)
   04072 Phospholipase D signaling pathway
    103014043 (PIK3CD)
   04071 Sphingolipid signaling pathway
    103014043 (PIK3CD)
   04024 cAMP signaling pathway
    103014043 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    103014043 (PIK3CD)
   04152 AMPK signaling pathway
    103014043 (PIK3CD)
   04150 mTOR signaling pathway
    103014043 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103014043 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    103014043 (PIK3CD)
   04218 Cellular senescence
    103014043 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103014043 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    103014043 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103014043 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103014043 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    103014043 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    103014043 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    103014043 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    103014043 (PIK3CD)
   04660 T cell receptor signaling pathway
    103014043 (PIK3CD)
   04662 B cell receptor signaling pathway
    103014043 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    103014043 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    103014043 (PIK3CD)
   04670 Leukocyte transendothelial migration
    103014043 (PIK3CD)
   04062 Chemokine signaling pathway
    103014043 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103014043 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    103014043 (PIK3CD)
   04929 GnRH secretion
    103014043 (PIK3CD)
   04915 Estrogen signaling pathway
    103014043 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    103014043 (PIK3CD)
   04917 Prolactin signaling pathway
    103014043 (PIK3CD)
   04926 Relaxin signaling pathway
    103014043 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    103014043 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    103014043 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103014043 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103014043 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    103014043 (PIK3CD)
   04722 Neurotrophin signaling pathway
    103014043 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103014043 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    103014043 (PIK3CD)
   04380 Osteoclast differentiation
    103014043 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    103014043 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    103014043 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014043 (PIK3CD)
   05206 MicroRNAs in cancer
    103014043 (PIK3CD)
   05205 Proteoglycans in cancer
    103014043 (PIK3CD)
   05203 Viral carcinogenesis
    103014043 (PIK3CD)
   05230 Central carbon metabolism in cancer
    103014043 (PIK3CD)
   05231 Choline metabolism in cancer
    103014043 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103014043 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103014043 (PIK3CD)
   05212 Pancreatic cancer
    103014043 (PIK3CD)
   05225 Hepatocellular carcinoma
    103014043 (PIK3CD)
   05226 Gastric cancer
    103014043 (PIK3CD)
   05214 Glioma
    103014043 (PIK3CD)
   05221 Acute myeloid leukemia
    103014043 (PIK3CD)
   05220 Chronic myeloid leukemia
    103014043 (PIK3CD)
   05218 Melanoma
    103014043 (PIK3CD)
   05211 Renal cell carcinoma
    103014043 (PIK3CD)
   05215 Prostate cancer
    103014043 (PIK3CD)
   05213 Endometrial cancer
    103014043 (PIK3CD)
   05224 Breast cancer
    103014043 (PIK3CD)
   05222 Small cell lung cancer
    103014043 (PIK3CD)
   05223 Non-small cell lung cancer
    103014043 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103014043 (PIK3CD)
   05017 Spinocerebellar ataxia
    103014043 (PIK3CD)
   05020 Prion disease
    103014043 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103014043 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103014043 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    103014043 (PIK3CD)
   04931 Insulin resistance
    103014043 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103014043 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103014043 (PIK3CD)
   05135 Yersinia infection
    103014043 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    103014043 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103014043 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    103014043 (PIK3CD)
   05161 Hepatitis B
    103014043 (PIK3CD)
   05160 Hepatitis C
    103014043 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    103014043 (PIK3CD)
   05164 Influenza A
    103014043 (PIK3CD)
   05162 Measles
    103014043 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    103014043 (PIK3CD)
   05163 Human cytomegalovirus infection
    103014043 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103014043 (PIK3CD)
   05169 Epstein-Barr virus infection
    103014043 (PIK3CD)
   05165 Human papillomavirus infection
    103014043 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103014043 (PIK3CD)
   05142 Chagas disease
    103014043 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103014043 (PIK3CD)
   01524 Platinum drug resistance
    103014043 (PIK3CD)
   01522 Endocrine resistance
    103014043 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103014043 (PIK3CD)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103014043 (PIK3CD)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103014043 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_p85B PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 103014043
NCBI-ProteinID: XP_007170088
UniProt: A0A383Z4K1
LinkDB
Position
Un
AA seq 1042 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWPQYEPLLPML
SDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLLIG
KGLHEFDSLQDPEVNDFRAKMRQFCEEVAAHRQQLGWEAWLQYSFPLQLEPSARSWGPGT
LRVPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYALQ
VNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAK
PPPIPLKKPASVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSSSE
VSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWAN
LMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAPHP
VYYPALDKILELGRHGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQEHF
PEALARLLLVTKWNKHEDVAQMLHLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSLRK
LTDDELFQYLLQLVQVLKYESYLDCELTKFLMDRALANRKIGHFLFWHLRSEMHVPSVAL
RFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDVVKVSSQKTTKPQTKELMHLCMRQE
TYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGTVGIIFKNGD
DLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDHTGLIEVVLHSDTIANIQLNKS
NMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIR
ENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCER
AYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEA
LRESWKTKVNWLAHNVSKDNRQ
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagagcgtg
gccgttgatttcttgctgcccacgggggtctatttgaacttccctgtgtcccgaaatgcc
aacctcagcaccatcaagaaggtgttgtggccccagtatgagccgctcctccccatgctc
agcgaccccgaggcctacgtgttcacctgcgtcaaccagaccgcggagcagcaggagctg
gaggacgagcagcggcggctgtgcgacatccagcccttcctgcccgtcctgcgcctggtg
gcccgcgagggtgaccgcgtgaagaagctcatcaactcgcagatcagcctgctcatcggc
aaaggcctccacgagttcgactccttgcaagacccggaggtgaatgacttccgagccaag
atgcgccagttctgcgaggaggtggccgcgcaccggcagcagctgggctgggaggcctgg
ctgcagtacagcttccccctgcagctggagccgtcggcgcggagctgggggccgggcacc
ctgcgcgtccccaaccgggccctgctcgtcaacgtcaagttcgagggcagcgaggagagc
ttcaccttccaggtgtccaccaaggatgtacccctggcactgatggcctgcgcgctccgg
aagaaggccacggtgttccggcagccgctggtggagcagcccgaggactacgcgctgcag
gtgaacgggaagcacgagtacctgtacggcagctaccccctctgccagttccagtacatc
tgcagctgcctgcacagcgggctgaccccccacctgaccatggtgcactcctcttccatc
ctcgccatgcgggacgagcagagcaaccccgccccccaagtccaaaagccgcgcgccaaa
ccgcccccgattcctctgaagaagcccgcctcggtgtccctgtggtccctggagcagcct
ttctgcatcgagctgatccagggcagcaaagtgaatgccgatgagcggatgaagctggtg
gtgcaggccggcctcttccacggcaacgagacgctgtgcaagacagtgtccagctcggag
gtgagcgtgtgctcggagcctgtgtggaagcagcggctggagtttgacatcaacgtctgc
gacctgccgcgcatggcccgcctctgctttgcgctctacgccgtgatcgagaaggccaag
aaggctcgctccaccaagaagaagtccaagaaggcggactgccccatcgcctgggccaac
ctcatgctgtttgattacaaggaccagctcaagaccggcgagcgctgcctctacatgtgg
ccctccgtcccagacgagaaaggggagctactgaacccctgtgggaccgtgcggagtaac
cccaacactgagagcgcggccgccctggtcatctttctccctgaggtggccccccaccct
gtatactaccctgccctggacaagatcctagagctggggcggcatggggagcacgggcgc
ttcacggaggaggagcagctgcagctgcgggagatcctggagcgccgggggtccggggag
ctatacgagcacgagaaggacctggtgtggaagatgcggcacgagatccaggagcacttc
cccgaggcgctggcccggttgctgctggtcaccaagtggaacaagcacgaggacgtggcc
cagatgctccacctgctgtgctcctggcccgagctgcccgtcctgagcgccctggagctg
ctggacttcagcttccctgaccgccacgtgggctcctttgccatcaagtccctgcggaaa
ctgacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaagtacgag
tcctacctcgactgcgagctgaccaaattcctgatggaccgagccctggccaatcgcaag
atcggccacttcctcttctggcacctgcgctccgagatgcacgtgccctcggtggccctg
cgcttcggcctcatcatggaggcctactgcaggggcagcacccatcacatgaaggtgctg
atgaagcagggggaagcgctgagcaaactgaaggccctgaacgacgtcgtcaaagtgagc
tcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcatgcgccaggag
acctacctggaggccctctcccacctgcagtccccgctcgaccccagcaccctgctggct
gaagtctgcgtggagcagtgcaccttcatggactccaagatgaagcccctgtgggtcatg
tacagcaatgaggaggcgggcagcgatggcaccgtgggcatcatctttaagaacggggac
gacctccgccaggacatgctgaccctgcagatgatccagctgatggacgttctgtggaag
caggagggcttggacctgaggatgaccccttatggctgcctctccaccggggaccacaca
ggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctgaacaagagc
aacatggcggccacggctgccttcaacaaggatgctctgctcaactggctcaagtccaag
aaccctggggaggccctggatcgagccattgaggagttcaccctctcctgcgctggctac
tgcgtggccacatacgtgctgggcatcggcgaccggcacagcgacaacatcatgatccga
gagaacgggcagctgttccacattgatttcggccactttctggggaatttcaagaccaag
tttggaatcaaccgtgagcgagtcccattcatcctcacctatgactttgtccacgtgatc
cagcaggggaagacgaataatagtgagaaatttgaaaggttccggggctactgtgaaagg
gcctacaccatcctgcggcgccacgggctgctctttctccacctctttgccctgatgcgg
gcggcaggcctgcctgagctcagctgctccaaagacatccagtacctcaaggattctctg
gcgttggggaagacggaggaggaggccctgaagcacttccgggtgaagtttaacgaagcc
ctccgggagagctggaaaaccaaagtcaactggctggcccacaacgtgtccaaagacaac
aggcaatag

DBGET integrated database retrieval system