KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007740
Entry
103007740         CDS       T03086                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04144  Endocytosis
bacu04145  Phagosome
bacu04218  Cellular senescence
bacu04514  Cell adhesion molecules
bacu04612  Antigen processing and presentation
bacu04940  Type I diabetes mellitus
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05203  Viral carcinogenesis
bacu05320  Autoimmune thyroid disease
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103007740
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103007740
   04145 Phagosome
    103007740
  09143 Cell growth and death
   04218 Cellular senescence
    103007740
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103007740
   04612 Antigen processing and presentation
    103007740
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103007740
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103007740
   05330 Allograft rejection
    103007740
   05332 Graft-versus-host disease
    103007740
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103007740
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103007740
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103007740
   05170 Human immunodeficiency virus 1 infection
    103007740
   05168 Herpes simplex virus 1 infection
    103007740
   05163 Human cytomegalovirus infection
    103007740
   05167 Kaposi sarcoma-associated herpesvirus infection
    103007740
   05169 Epstein-Barr virus infection
    103007740
   05165 Human papillomavirus infection
    103007740
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103007740
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bacu00537]
    103007740
Exosome [BR:bacu04147]
 Exosomal proteins
  Proteins found in most exosomes
   103007740
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bacu00537]
 Antigens
  103007740
SSDB
Motif
Pfam: MHC_I C1-set Rax2 MHC_I_3 Shisa
Other DBs
NCBI-GeneID: 103007740
NCBI-ProteinID: XP_007173556
UniProt: A0A383ZEQ5
LinkDB
Position
Un
AA seq 349 aa
MAELAHLKLEKKPWPARTHSLHYYYLALSEPGPSLPKFLAVGYVDDQPFIRFDSRVGKAE
PQAPWMTPMDAQYWETETKKQEKWAEVQQVEMWTVMGYHNHSSGMHSTQRMFGCEIQEDG
RYRGFWQFGYDGQDHLSLDLETLSWVSAEPVATRTKHWWETERCYAEYDKAYLEGPCLAS
LHRYLELGGQRFSRREPPAVRITKHSAKDGGTTLRCWALGFYPHDILLSWWLGEKELDSE
YVETRPSGDGTYQTWAAVWVPAGEKAQYTCHVQHSSLNHTLTVSWESSHPGLIAMVISLI
LVLLVVVGGVILTKCIQARNKESYEQAPGGEDPHNSQSPARAGATQLIC
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggcagaactggcacacctgaagttggaaaagaagccgtggcctgcaaggacacactca
ctccactactattacctggccctatcagagccaggcccgagcctcccgaagtttctggct
gtgggctacgtggacgaccagcccttcatccggtttgacagtcgtgtgggcaaggctgag
ccccaggccccatggatgacgccaatggatgcccagtactgggagacggagaccaagaag
caggagaaatgggcggaggtgcagcaggtggagatgtggacggtgatgggctaccacaac
cacagcagcggcatgcacagcactcagcgcatgttcggctgtgagatccaggaagacggc
cgctacaggggcttctggcagtttggctacgatgggcaggaccacctgtcgctggacctg
gaaaccctgagctgggtgtcagctgagcccgtggccacgcggaccaagcactggtgggag
acagagcgctgctacgcagagtacgacaaggcctacctggaaggcccctgccttgcctcc
ctgcacagatacctggagctgggaggccagagattcagccggagagagccacccgcagtg
cggataacaaagcactcggccaaggatgggggcaccaccctgaggtgctgggccctgggc
ttctatccacacgacatcttgctgagctggtggctgggggagaaggagctggattctgaa
tacgtggagacacgccccagtggggacggcacctatcagacgtgggcggctgtgtgggtg
ccggcgggggagaaggcccagtacacctgccacgtgcagcactccagcctgaaccacacg
ctcactgtgtcctgggagtcctctcatcctggacttattgccatggttatctccctcatc
ctggtcttgctggtggttgttggtggtgtaatcttgaccaagtgcattcaagccaggaat
aaggaatcttacgagcaagccccaggtggagaggacccccataattcccaaagcccagca
agagcaggggctactcaactcatctgctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008230
Entry
103008230         CDS       T03086                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04144  Endocytosis
bacu04145  Phagosome
bacu04218  Cellular senescence
bacu04514  Cell adhesion molecules
bacu04612  Antigen processing and presentation
bacu04940  Type I diabetes mellitus
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05203  Viral carcinogenesis
bacu05320  Autoimmune thyroid disease
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103008230
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103008230
   04145 Phagosome
    103008230
  09143 Cell growth and death
   04218 Cellular senescence
    103008230
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103008230
   04612 Antigen processing and presentation
    103008230
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103008230
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103008230
   05330 Allograft rejection
    103008230
   05332 Graft-versus-host disease
    103008230
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103008230
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103008230
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103008230
   05170 Human immunodeficiency virus 1 infection
    103008230
   05168 Herpes simplex virus 1 infection
    103008230
   05163 Human cytomegalovirus infection
    103008230
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008230
   05169 Epstein-Barr virus infection
    103008230
   05165 Human papillomavirus infection
    103008230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103008230
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bacu00537]
    103008230
Exosome [BR:bacu04147]
 Exosomal proteins
  Proteins found in most exosomes
   103008230
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bacu00537]
 Antigens
  103008230
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set C2-set_2 DUF3188 Psg1 ig
Other DBs
NCBI-GeneID: 103008230
NCBI-ProteinID: XP_007194047
UniProt: A0A384B343
LinkDB
Position
Un
AA seq 365 aa
MRVMAPRTLLLLLSGALALTETWAGSHSLRYFHTGVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAPNPRMEPRAPWVEQEGPEYWDRETRISKDHAQVYRANLNTLRVYYNQSEAGSHTLQ
GMYGCDVGPDGRLLRGYSQYAYDGADYIALNEDLRSWTAADEPAQITKRKFETVGAAERN
RAYLEGACVEALLRYLETGKDTLQRADPPKTHVTHHPISDREVTLRCWALGFYPEEISLT
WQRDGEDQTQDMELVETRPSGDGTFQKWAALVVPSGEEQRYACHVQHEGLQEPLTLRWEP
PQPTVPIMGLIVGLVPLVVTGAVVVVAGAVIWRKKHSGEKGGSYAQAASSDSAQGSDVSL
TDPKV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccgcgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggcaggctcccactccctgaggtatttccacaccggggtgtcacggcccggc
cgcggggagccccgcttcatcgccgtcggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccccgaatccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggatcgggagacgcggatctccaaggaccacgcacaggtgtaccgagcg
aacctgaacaccctgcgcgtctactacaaccagagcgaggccgggtctcacaccctccag
gggatgtacggctgcgacgtggggccggacggtcgcctcctccgcgggtacagtcagtac
gcctacgacggcgccgattacatcgccctgaacgaggacctgcgctcctggaccgcggcc
gacgagccggctcagatcaccaagcgcaagtttgagacggttggtgctgcggagcgcaac
agagcctacctggaaggggcatgcgtagaggcgctcctcagatacctggagaccgggaag
gacacgctgcagcgcgcagatcctccaaagacacatgtgacccatcaccccatctctgac
cgtgaggtcaccctgaggtgctgggccctgggcttctaccctgaggagatttcactgacc
tggcaacgtgatggagaggatcagacccaggacatggagcttgtggagaccaggccttca
ggggatggaaccttccagaagtgggcggccctggtggtgccttctggagaggagcagaga
tacgcgtgccatgtgcagcacgaggggcttcaggagcctctcaccctgagatgggaacct
cctcagcccaccgtccccatcatgggcctcattgttggcctggttcccttggtggtcact
ggagccgtggtggtggtggctggagctgtgatctggaggaagaagcactcaggtgaaaaa
ggagggagctatgctcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctc
acggatcctaaagtgtga

DBGET integrated database retrieval system