KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007749Help
Entry
103007749         CDS       T03086                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04910  Insulin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04931  Insulin resistance
Module
bacu_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103007749 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103007749 (GYS2)
   04152 AMPK signaling pathway
    103007749 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103007749 (GYS2)
   04922 Glucagon signaling pathway
    103007749 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    103007749 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bacu01003]
    103007749 (GYS2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103007749 (GYS2)
Glycosyltransferases [BR:bacu01003]
 Polysaccharide
  Storage polysaccharide
   103007749 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 103007749
NCBI-ProteinID: XP_007194888
UniProt: A0A384B5N7
LinkDB All DBs
Position
Un
AA seq 700 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEARLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGD
NYFLLGPYFEHNMKAQVEQCEPVNDAVRRAVDTMNKHGCQVYFGRWLIEGSPYVVLFDIG
YSAWNLDTWKGDLWEACNVGIPHHDQEANEMLIFGSLTAWFLKEVTDHADGKHIIVQFHE
WQAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAVEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMYK
ARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESFSXXLLRMHKSDVTVV
VFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNILDRD
DLTVMKRAIFSTQRRSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPEFLS
STSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVA
DPTAYGIYIVDRRFRSLDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGR
YYQHARHLTLSRAFPDKFHTETTSPPMTEGFKYPRPSSVPPSPSGSQVSSPQSSDVEDEN
EEERYDEEEEAERDRLNIKSPLSLNHVPRGKKKLHGEYKN
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatcgctatctgtgacatccctgggtgggcttcctcggtgggaagcc
agactccctgtggaggatttacttctctttgaagtcgcttgggaagtgaccaataaagtt
ggtggcatctacactgtgattcagacaaaggccaaaacaacagcagatgagtggggagac
aactactttctgcttggtccatattttgagcataatatgaaggctcaggtggaacaatgt
gaacctgtaaatgatgctgtgagaagagcagtggacacaatgaacaaacatggctgccag
gtgtactttggaagatggctgatagaagggagtccttacgtggtgctctttgacataggc
tattcggcttggaacctggacacgtggaaaggtgacctctgggaagcatgcaatgttggt
atccctcatcacgaccaggaagccaatgaaatgctgatatttggatcgttaactgcctgg
ttcttgaaagaggtgacagatcatgccgatgggaaacacatcattgtccaattccatgaa
tggcaggctgggactggactgattctttctcgagctcggaaacttccgatcgctacagtc
tttaccactcacgccacactgctggggaggtatctctgtgcagcaaacatcgatttctac
aaccatcttgataagtttaacatagacaaagaggctggggaaaggcagatttatcaccgg
tattgcatggagcgtgcctcagtccattgtgctcatgtattcaccactgtttctgaaata
acagcagtagaggcagaacacatgctgaagagaaagcctgatgtaattactccaaatggc
ttgaatgttaagaaattttcagcagtacatgagtttcaaaatctccatgccatgtacaag
gccaggatccaagattttgttcgaggtcatttctatggtcatctggactttgatcttgaa
aaaacgttgttcctcttcattgctgggaggtatgagttttcaaacaaaggagctgacatc
ttcctagaatccttctccnnnnnnctgctgaggatgcataaaagtgacgtcaccgtggtg
gtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctgaaaggccag
gcagtgcgaaaacagctatgggacactgcacattctgtgaaggaaaagtttgggaagaaa
ctgtatgatgcattattaagaggagaaattcctgacatgaacaatattttggatcgagac
gatctgacagttatgaaaagagccatcttttcaactcagcggcgatctttgccccccgtg
acgactcacaacatgattgatgactccacagatcccatcctcagcaccattagaaggatc
gggcttttcaacagccgcacagacagagtcaaggtgattttgcacccagagttcctatcc
tctaccagccccttgttacccatggattatgaagagtttgtccgaggttgtcatcttgga
gtatttccatcatactatgaaccctggggttatactccagccgaatgcactgtgatgggt
atccccagcgtgaccaccaacctctccggctttggctgtttcatgcaggagcatgtggct
gatcccactgcatacggtatttacatcgttgacaggcgattccgctcactggatgattct
tgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgccagaggatt
attcagaggaaccgaaccgagaggctttcagaccttctggattggagatacttaggcaga
tattaccagcatgccaggcacctgacattaagcagagcttttccagataaattccacacg
gaaaccacatcgccaccaatgacagaagggtttaaatatcccaggccttcctcagtacca
ccttctccttcgggatctcaggtctctagtcctcagagcagcgatgtggaggatgagaat
gaggaagaaagatacgatgaagaagaggaggctgaaagggatcggttaaatatcaagtca
ccattgtctctgaatcatgttcctcgcgggaagaagaagctgcacggcgaatacaagaac
tga

DBGET integrated database retrieval system