KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007760
Entry
103007760         CDS       T03086                                 

Gene name
E2F3
Definition
(RefSeq) E2F transcription factor 3
  KO
K06620  transcription factor E2F3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04110  Cell cycle
bacu04218  Cellular senescence
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103007760 (E2F3)
   04218 Cellular senescence
    103007760 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103007760 (E2F3)
   05206 MicroRNAs in cancer
    103007760 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103007760 (E2F3)
   05225 Hepatocellular carcinoma
    103007760 (E2F3)
   05226 Gastric cancer
    103007760 (E2F3)
   05214 Glioma
    103007760 (E2F3)
   05220 Chronic myeloid leukemia
    103007760 (E2F3)
   05218 Melanoma
    103007760 (E2F3)
   05219 Bladder cancer
    103007760 (E2F3)
   05215 Prostate cancer
    103007760 (E2F3)
   05224 Breast cancer
    103007760 (E2F3)
   05222 Small cell lung cancer
    103007760 (E2F3)
   05223 Non-small cell lung cancer
    103007760 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103007760 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103007760 (E2F3)
   05161 Hepatitis B
    103007760 (E2F3)
   05160 Hepatitis C
    103007760 (E2F3)
   05163 Human cytomegalovirus infection
    103007760 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103007760 (E2F3)
   05169 Epstein-Barr virus infection
    103007760 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103007760 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103007760 (E2F3)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103007760 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 103007760
NCBI-ProteinID: XP_007197212
UniProt: A0A384BBW6
LinkDB
Position
Un
AA seq 340 aa
MPLQQQAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPVKTNN
QDHNGNISKPTSKDLASTNSGHSDCSISMADLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgcaggctggagctaggagaaagcggtcagcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcgctccgaagtccagat
agtccaaaaactccaaaatctccctcagaaaaaacacggtatgatacatcacttggtctg
ctcaccaagaagttcattcagctactgagccaatcacctgatggggtcttggatttgaac
aaggcagcagaggtgctgaaggtacaaaagagaaggatttatgacatcaccaatgtgctg
gaaggcattcacctcattaagaagaagtctaaaaacaacgtgcagtggatgggctgcagt
ctgtctgaggacgggggcatgctggcccagtgtcaaggcctgtctaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgacccaatagagagcctgcaaatacatttggcaagtacccaaggaccc
attgaggtttatttgtgtccagaagagactgaaacacacagtccagtgaaaacaaacaac
caagaccacaatgggaatatctctaaacccacttccaaagacttggcttcaaccaactca
ggacatagtgattgctcgatttccatggcagacctttctcccttggcctccccagccaac
cttttacagcagaccgaggaccaaattccttccaacctagaaggaccatttgtgaactta
ctgccccccctgctccaagaagactatctcctaagccttggggaggaggaaggcatcagc
gatctctttgatgcttacgatttggaaaagctcccactggtggaagactttatgtgtagc
tga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015828
Entry
103015828         CDS       T03086                                 

Gene name
E2F1
Definition
(RefSeq) E2F transcription factor 1
  KO
K17454  transcription factor E2F1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04110  Cell cycle
bacu04137  Mitophagy - animal
bacu04218  Cellular senescence
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103015828 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    103015828 (E2F1)
   04218 Cellular senescence
    103015828 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015828 (E2F1)
   05206 MicroRNAs in cancer
    103015828 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103015828 (E2F1)
   05225 Hepatocellular carcinoma
    103015828 (E2F1)
   05226 Gastric cancer
    103015828 (E2F1)
   05214 Glioma
    103015828 (E2F1)
   05220 Chronic myeloid leukemia
    103015828 (E2F1)
   05218 Melanoma
    103015828 (E2F1)
   05219 Bladder cancer
    103015828 (E2F1)
   05215 Prostate cancer
    103015828 (E2F1)
   05224 Breast cancer
    103015828 (E2F1)
   05222 Small cell lung cancer
    103015828 (E2F1)
   05223 Non-small cell lung cancer
    103015828 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103015828 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103015828 (E2F1)
   05161 Hepatitis B
    103015828 (E2F1)
   05160 Hepatitis C
    103015828 (E2F1)
   05163 Human cytomegalovirus infection
    103015828 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103015828 (E2F1)
   05169 Epstein-Barr virus infection
    103015828 (E2F1)
   05165 Human papillomavirus infection
    103015828 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103015828 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103015828 (E2F1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103015828 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 103015828
NCBI-ProteinID: XP_007193442
UniProt: A0A384B1A9
LinkDB
Position
Un
AA seq 361 aa
MVGGFDDRTQVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTK
RFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHAAV
GIGGRLEGLTQDLQQLQESERQLDHLIHICTTQLRLLSEDADSQRLAYVTCQDLRSIADP
AEQMVMVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEESAGGISPGKTPSQGAA
SGEEERAADPATTVPPPPSSSPPSSPATDPSQSLLSLEQEPLLSRMGSLRAPMDEDRLSP
LVAADSLLEHVREDFAGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLD
F
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggttggagggtttgatgatcgcacgcaggtgaagcggaggctggacttggaaactgac
catcagtacctggccgagagcagtgggccagctcggggcagaggccgccacccaggaaaa
ggtgtgaaatccccaggggagaagtcacgctatgaaacatcgctgaatctgactaccaag
cgcttcctggagttgctgagccgctcggccgatggtgtcgtcgacctgaactgggcagct
gaggtgctgaaggtgcagaaacggcgcatctacgacatcaccaacgtcctcgagggcatc
cagctcatcgccaagaagtccaagaaccacatccagtggctaggcagccatgcagcagtg
gggatcggtgggcggcttgaaggattgacccaggacctccagcaactgcaggaaagcgag
cggcagctggaccacctgatccacatctgcaccacgcagctgcgtctgctttccgaggat
gctgacagccagcgcctggcctacgtgacctgccaggaccttcgtagcattgcggaccct
gcagaacagatggttatggtgatcaaggcccctcccgagacccagcttcaagccgtggac
tcctcagagacctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctg
tgccctgaggagagtgcgggcgggatcagccccgggaagaccccgtcccagggtgcagct
tctggggaggaggagagggcagctgaccctgccaccacagtgccaccaccaccatcatca
tctcccccctcatcccctgccacggatcccagtcagtccctgctaagcctggagcaagaa
cctctgctttcccggatgggcagcctgcgggcccccatggacgaggaccgcctgtcccca
ctggtggcggccgactcgctcctggagcacgtgcgggaggactttgccggcctcctcccc
gaggagttcatcagcctgtcccccccgcacgaggccctcgactaccacttcggccttgag
gagggcgagggcatcagagacctcttcgactgtgactttggggacctcactcccctggat
ttctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017714
Entry
103017714         CDS       T03086                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04110  Cell cycle
bacu04218  Cellular senescence
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103017714 (E2F2)
   04218 Cellular senescence
    103017714 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017714 (E2F2)
   05206 MicroRNAs in cancer
    103017714 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103017714 (E2F2)
   05225 Hepatocellular carcinoma
    103017714 (E2F2)
   05226 Gastric cancer
    103017714 (E2F2)
   05214 Glioma
    103017714 (E2F2)
   05220 Chronic myeloid leukemia
    103017714 (E2F2)
   05218 Melanoma
    103017714 (E2F2)
   05219 Bladder cancer
    103017714 (E2F2)
   05215 Prostate cancer
    103017714 (E2F2)
   05224 Breast cancer
    103017714 (E2F2)
   05222 Small cell lung cancer
    103017714 (E2F2)
   05223 Non-small cell lung cancer
    103017714 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103017714 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103017714 (E2F2)
   05161 Hepatitis B
    103017714 (E2F2)
   05160 Hepatitis C
    103017714 (E2F2)
   05163 Human cytomegalovirus infection
    103017714 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103017714 (E2F2)
   05169 Epstein-Barr virus infection
    103017714 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103017714 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103017714 (E2F2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    103017714 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 103017714
NCBI-ProteinID: XP_007175240
LinkDB
Position
Un
AA seq 554 aa
MVPFPRRPVTASLAVDVPDNQLRLRVGSARSLLYWEKRSPQPLLCAGLRSGRCSLGAPPP
CFLPRQLCPGRAAALDRTPFLPSFILSGNSHSSNACDVPRTRPFRPSECGPRPTGVLREA
WPRALAPAAGPPPKGLPTMSPTELWPPGLSSPQLCPATTTYYTQLYPQTVPPAAAPGTCL
DATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPVVPEFWTPKRKCIRVDGLPSPKTPKS
PGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIR
KKAKNNIQWVGRGLFEDPTRPGKQQQLGQELKELMSMEQALDQLIQSCSLNFKHLTEDKA
NKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEVYLC
PEEVQEPNSPAKEPLPSTSALSPSPDPTQPSSSINPGITESTASSAPVLTSQQVLPPLPP
SLVPLEATDSMLEPSHPLLQQTEDQLLSPTPPCGSPLISFSPPLDQDDYLWGLDGGEGIS
DLFDTYDLGDLLIN
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggtgccctttccgagaaggccagttacagcatccttagctgtggatgtgccggacaac
caactgcgcctccgggtcggctctgcccgctccctgctctactgggagaagcgttccccg
cagcctcttctctgcgccgggctgcgctcgggccgctgcagcctcggcgcgcccccaccc
tgcttcctgcctcggcagctttgcccgggccgggcggccgccctggatcgcaccccgttc
cttccttccttcattctttcaggcaactcgcattcctcgaacgcctgcgacgtgccccgc
acaaggcctttccgaccttccgagtgtggccccaggcccaccggggtcctccgggaagcc
tggccgcgggccctggctccggccgcggggccgccccccaaggggctgcccacgatgagc
cccacggagctgtggccgcccggcctcagcagccctcagctctgcccggccaccaccacc
tactacacccagctgtacccgcagactgtgcctcccgctgcggcgccgggcacctgcctc
gacgccaccccccacggaccggagggccaagctgtgcgatgcgtgcctgctggccggctg
ccggccaaaaggaagctggacctggaggggatcgggaggcctgtggtccctgaattctgg
actcccaagcggaagtgcattagagtggatggcctccccagccccaaaacccccaagtcg
cctggggagaagactcgctatgacacgtcgctggggctgctcaccaagaaattcatttac
ctcctgagcgagtctgaggatggggtcctggaccttaactgggcggctgaggtgctggac
gtgcagaagcggcgcatctacgacataaccaatgtgctggagggcatccagctcatccgc
aagaaggccaagaacaacatccagtgggtaggcagaggactgtttgaagaccccacccgg
cctgggaagcagcagcagctggggcaggagctgaaggagctaatgagcatggagcaggcc
ttggaccagctcatccagagctgctctctgaacttcaagcacctgacggaggacaaggcc
aacaagagactggcctacgtgacttaccaggacatccgtgctgtgggcaactttaaggag
cagacggtgatcgctgtcaaggcccctccgcagacgagactggaagtgcctgacaggagc
gaggagaacctgcagatatatctgaagagcacgcagggccccatcgaagtctacctgtgc
ccagaagaggtccaggagcccaacagtcctgccaaggagcccctcccctccacctccgcc
ctcagtcccagccctgaccccacccagcccagcagcagcatcaaccctggaatcacggaa
tccacggcatcctcagcaccagtgctgacgtcccagcaggtcctgccgccactcccgccg
tcccttgtcccgctggaggccaccgacagcatgctggagccgtcacacccactcctgcag
cagaccgaagaccagctcctgtccccgacaccgccgtgcggctcccctctgatcagcttc
tccccgcccttggaccaggacgactacctgtggggcctggacggcggggagggcatcagt
gacctcttcgacacctatgacctcggggacctactgattaactga

DBGET integrated database retrieval system