KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007995
Entry
103007995         CDS       T03086                                 

Gene name
RAC1
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04530  Tight junction
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04972  Pancreatic secretion
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05231  Choline metabolism in cancer
bacu05416  Viral myocarditis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103007995 (RAC1)
   04014 Ras signaling pathway
    103007995 (RAC1)
   04015 Rap1 signaling pathway
    103007995 (RAC1)
   04310 Wnt signaling pathway
    103007995 (RAC1)
   04370 VEGF signaling pathway
    103007995 (RAC1)
   04071 Sphingolipid signaling pathway
    103007995 (RAC1)
   04024 cAMP signaling pathway
    103007995 (RAC1)
   04151 PI3K-Akt signaling pathway
    103007995 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103007995 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103007995 (RAC1)
   04520 Adherens junction
    103007995 (RAC1)
   04530 Tight junction
    103007995 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103007995 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103007995 (RAC1)
   04620 Toll-like receptor signaling pathway
    103007995 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    103007995 (RAC1)
   04662 B cell receptor signaling pathway
    103007995 (RAC1)
   04664 Fc epsilon RI signaling pathway
    103007995 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    103007995 (RAC1)
   04670 Leukocyte transendothelial migration
    103007995 (RAC1)
   04062 Chemokine signaling pathway
    103007995 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    103007995 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103007995 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    103007995 (RAC1)
   04380 Osteoclast differentiation
    103007995 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103007995 (RAC1)
   05205 Proteoglycans in cancer
    103007995 (RAC1)
   05203 Viral carcinogenesis
    103007995 (RAC1)
   05231 Choline metabolism in cancer
    103007995 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103007995 (RAC1)
   05212 Pancreatic cancer
    103007995 (RAC1)
   05211 Renal cell carcinoma
    103007995 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103007995 (RAC1)
   05020 Prion disease
    103007995 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    103007995 (RAC1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103007995 (RAC1)
   05416 Viral myocarditis
    103007995 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103007995 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103007995 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103007995 (RAC1)
   05135 Yersinia infection
    103007995 (RAC1)
   05100 Bacterial invasion of epithelial cells
    103007995 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103007995 (RAC1)
   05163 Human cytomegalovirus infection
    103007995 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103007995 (RAC1)
   05169 Epstein-Barr virus infection
    103007995 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103007995 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103007995 (RAC1)
   04031 GTP-binding proteins [BR:bacu04031]
    103007995 (RAC1)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    103007995 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    103007995 (RAC1)
  Macropinocytosis
   Ras GTPases
    103007995 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    103007995 (RAC1)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103007995 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   103007995 (RAC1)
  Exosomal proteins of colorectal cancer cells
   103007995 (RAC1)
  Exosomal proteins of bladder cancer cells
   103007995 (RAC1)
GTP-binding proteins [BR:bacu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103007995 (RAC1)
SSDB
Motif
Pfam: Ras Roc Arf CagD
Other DBs
NCBI-GeneID: 103007995
NCBI-ProteinID: XP_007186802
UniProt: A0A384AHH4
LinkDB
Position
Un
AA seq 201 aa
MKSKTAFMLTKQLTPFFSLFRAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPV
NLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPII
LVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDE
AIRAVLCPPPVKKRKRKCLLL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaatctaagactgcattcatgttgactaagcaacttacaccatttttttctctcttc
agagctgtaggtaaaacttgcctcctgatcagttacacgaccaatgcctttcctggagag
tatatccccactgtctttgacaactattctgccaatgttatggtggatggaaaaccggtg
aatctgggcttgtgggatacggctggacaagaagattatgaccgattgcgccccctctcc
tatccgcagacggatgtattcttgatttgcttttctcttgtgagtcctgcatcatttgaa
aatgttcgtgcaaagtggtaccctgaagtgcgacaccactgtcccaacactcctatcatc
ctggtggggacgaaacttgacctgagggatgataaagacacgattgagaaactgaaggag
aagaagctgacgcccatcacctacccgcagggcttggccatggccaaggagatcggtgcc
gtcaaatacctggagtgctcggcgctcacgcagcgaggtctcaagacggtgtttgatgaa
gctatccgggcggttctctgcccgccccccgtcaagaagaggaagagaaaatgcctgctg
ttgtga

DBGET integrated database retrieval system