KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008131
Entry
103008131         CDS       T03086                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04926  Relaxin signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05219  Bladder cancer
bacu05323  Rheumatoid arthritis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008131 (VEGFA)
   04014 Ras signaling pathway
    103008131 (VEGFA)
   04015 Rap1 signaling pathway
    103008131 (VEGFA)
   04370 VEGF signaling pathway
    103008131 (VEGFA)
   04066 HIF-1 signaling pathway
    103008131 (VEGFA)
   04020 Calcium signaling pathway
    103008131 (VEGFA)
   04151 PI3K-Akt signaling pathway
    103008131 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103008131 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103008131 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008131 (VEGFA)
   05206 MicroRNAs in cancer
    103008131 (VEGFA)
   05205 Proteoglycans in cancer
    103008131 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103008131 (VEGFA)
   05211 Renal cell carcinoma
    103008131 (VEGFA)
   05219 Bladder cancer
    103008131 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103008131 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103008131 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103008131 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103008131 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008131 (VEGFA)
   05165 Human papillomavirus infection
    103008131 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103008131 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103008131 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103008131 (VEGFA)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103008131 (VEGFA)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103008131 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 103008131
NCBI-ProteinID: XP_007193858
LinkDB
Position
Un
AA seq 230 aa
MIAVRSRAAWAQPGALSRLNLKSRLGDSLLPSPPPHFRWSQAAPMAEGEQKPHEVVKFMD
VYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQ
IMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSA
PCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatcgctgtcaggagtcgggctgcctgggcccagccgggtgctttgtcgagactcaac
ctaaagtcccgacttggtgacagtctgcttccctcccctcccccacacttccgatggtcc
caggctgcacccatggcagaaggagagcagaaacctcacgaagtggtgaagttcatggac
gtctaccagcgcagctactgccgtccaattgagaccctggtggacatcttccaggagtac
cctgatgagatcgagtacatcttcaagccgtcctgtgtgcccctgatgcggtgtgggggc
tgctgcaatgatgagggtctggagtgtgtgcccaccgaagagttcaacatcaccatgcag
attatgcggatcaaacctcaccaaggccagcacataggagagatgagcttcttacagcac
aacaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaaaaatcagttcga
ggaaagggaaaggggcaaaaaagaaagcgcaagaaatcccggtataaatcctggagcgct
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system