KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008224
Entry
103008224         CDS       T03086                                 

Gene name
CTNNA2
Definition
(RefSeq) catenin alpha 2
  KO
K05691  catenin alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04670  Leukocyte transendothelial migration
bacu05100  Bacterial invasion of epithelial cells
bacu05200  Pathways in cancer
bacu05213  Endometrial cancer
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    103008224 (CTNNA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103008224 (CTNNA2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103008224 (CTNNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008224 (CTNNA2)
  09162 Cancer: specific types
   05226 Gastric cancer
    103008224 (CTNNA2)
   05213 Endometrial cancer
    103008224 (CTNNA2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103008224 (CTNNA2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103008224 (CTNNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103008224 (CTNNA2)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     103008224 (CTNNA2)
SSDB
Motif
Pfam: Vinculin CorA
Other DBs
NCBI-GeneID: 103008224
NCBI-ProteinID: XP_007193077
UniProt: A0A384B096
LinkDB
Position
Un
AA seq 969 aa
MEGTLREENHFRFSGSMTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNK
GPSGKKKGRSKKAHVLAASVEQATQNFLEKGEQIAKESQDLKEELVAAVEDVRKQGETMR
IASSEFADDPCSSVKRGTMVRAARALLSAVTRLLILADMADVMRLLSHLRIVEEALEAVK
NATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAARGALKKNATMLYTAS
QAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAALNEFD
NKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQD
LLSEYMNNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIE
AAKSGNEKEVKEYAQVFREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVIN
AALTLAARPQSKVAQDNMDVFKDQWEKQVRVLTEAVDDITSVDDFLSVSENHILEDVNKC
VIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMENYEAGVYTEKVLEATKLLSETVMPR
FAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMIRTPEELEDDSDFEQ
EDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAEVAKW
DDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVAD
QCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVD
CDVIDGGRASQLSTHLPTCAEGAPIGCGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASY
VASTKYQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHISPVQAL
SEFKAMDSF
NT seq 2910 nt   +upstreamnt  +downstreamnt
atggaaggcactctgagggaggaaaaccactttcgtttttcagggagcatgacttcggca
acttcacctatcatattaaaatgggaccccaaaagtttggaaatacggactctaacagtg
gagagacttttggagccacttgttacacaggtgacgacccttgtcaacacaagcaacaaa
ggcccatctggtaaaaagaaagggaggtcaaagaaagcccatgtactggctgcatctgta
gagcaagccactcagaactttctggaaaagggtgaacagattgctaaggagagtcaagat
ctcaaagaagaattggttgctgctgttgaggatgtacgcaaacaaggtgagacgatgcgc
attgcctcttccgagttcgctgatgacccgtgctcctcggtgaagcgtggcaccatggtg
cgagctgcccgggctctgctatcggctgtaacacgcttgctcatcctggcggacatggca
gacgtcatgagacttttatctcatctgagaattgtggaggaggccttggaagctgtcaaa
aatgctacaaatgagcaagaccttgcaaatcgctttaaagaatttggaaaagagatggtg
aaacttaactatgtagctgcaagaagacaacaggagctgaaggaccctcattgtcgggat
gagatggcagctgcccgaggggctctaaagaagaacgccacaatgctgtacacagcctcc
caagcctttctccgccacccagatgttgccgccaccagagccaaccgagattacgtgttc
aaacaagtgcaggaggccattgccggcatctccaatgctgctcaagctacctcgcccacc
gacgaagccaaaggccacacgggcatcggggagctggctgcggctctgaacgaatttgac
aacaagatcatcctggaccccatgacgttcagcgaggcccggttccggccgtcgctagag
gagcgcctggagagtatcatcagcggcgcggctctcatggccgactcctcgtgcacccgc
gacgaccggcgcgagcggatcgtggccgagtgcaacgccgtgcgccaggcgctccaggac
ctgctcagcgagtacatgaacaacactggaagaaaagaaaaaggagatcctctaaacatt
gcaattgataagatgaccaagaaaacaagggatctaaggagacagcttcggaaagcagtg
atggatcacatatctgattctttcttggaaaccaacgtccctttgctagttctcattgag
gctgcaaaaagtgggaatgagaaggaagtgaaggaatacgcccaggttttccgcgagcat
gccaacaagctggtggaggttgccaatttggcctgttccatctccaacaatgaagaaggg
gtgaaattagttcggatggcagccacccagattgacagcctgtgtccccaggtcatcaat
gccgctctcacactggctgcccggccacagagcaaagttgctcaggataatatggatgtc
ttcaaagaccagtgggaaaagcaggtccgagtgctgacagaggctgtggatgacatcacc
tcagtggatgacttcctttctgtctcagaaaatcatatcttggaggatgtgaataagtgt
gtgatagcccttcaagagggggatgtggacactctggaccggactgcaggggctatcagg
ggccgggcagctcgagtcatacacatcatcaatgctgagatggagaactatgaagctgga
gtttatactgagaaggtgctggaagctacaaaattgctctctgagacagtgatgccacgc
tttgctgaacaagtggaggttgccattgaagccctgagtgccaacgtccctcaaccattt
gaagagaacgagttcatcgacgcttctcgcctggtatacgatggcgttcgggacatcaga
aaggctgtgctgatgatcaggaccccagaagaactagaggatgattcagactttgagcag
gaagattatgatgtacgtagccggacaagtgttcagacggaggatgaccagctcattgca
ggacagagtgcacgggccatcatggcacaactaccgcaagaggagaaggcaaaaatagct
gagcaggtggagatattccaccaagagaaaagcaagctggatgctgaagtggccaaatgg
gacgacagcggcaatgatatcattgtgctggccaagcagatgtgtatgatcatgatggaa
atgacagacttcacaagaggcaaaggcccgttgaaaaatacatctgatgtgattaatgcc
gccaagaaaattgccgaagcaggctctcgaatggacaaattagcccgagctgtggctgat
cagtgtcctgattcagcatgtaagcaggatttattagcctaccttcaacgaattgccttg
tattgccatcaacttaatatctgcagcaaggtgaaagccgaagtacagaatctgggagga
gagctcattgtgtcagggacaggagttcagagcactttcactaccttttatgaggtagat
tgtgatgtcatagatgggggcagggctagtcaactttctacccacctcccaacctgtgct
gagggagctccgatcgggtgtggaagcagtgattcttccatgctggacagtgccacatcg
ctcattcaggcagctaaaaatctgatgaatgctgttgtcctcacggtgaaagcatcttat
gtggcctcaacaaaatatcagaaggtctatgggacagcagctgtcaactcacctgttgtg
tcttggaagatgaaggctccagagaagaagccccttgtgaagagagaaaagcctgaagaa
ttccagacgcgagttagacgaggttctcagaagaaacacatttcgcctgtacaggcttta
agtgaattcaaagcaatggattccttctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012066
Entry
103012066         CDS       T03086                                 

Gene name
CTNNA3
Definition
(RefSeq) catenin (cadherin-associated protein), alpha 3
  KO
K05691  catenin alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04670  Leukocyte transendothelial migration
bacu05100  Bacterial invasion of epithelial cells
bacu05200  Pathways in cancer
bacu05213  Endometrial cancer
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    103012066 (CTNNA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103012066 (CTNNA3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103012066 (CTNNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012066 (CTNNA3)
  09162 Cancer: specific types
   05226 Gastric cancer
    103012066 (CTNNA3)
   05213 Endometrial cancer
    103012066 (CTNNA3)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103012066 (CTNNA3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103012066 (CTNNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103012066 (CTNNA3)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     103012066 (CTNNA3)
SSDB
Motif
Pfam: Vinculin AAA_32
Other DBs
NCBI-GeneID: 103012066
NCBI-ProteinID: XP_007167878
UniProt: A0A383YYD8
LinkDB
Position
Un
AA seq 944 aa
MGTLAGGLRTKFCALVSIVPTGNDTSIALKEDHPSPLDANLLRLLIKAVMSAETSITLNV
NPQDLQVQTFTVEKLLEPLIIQVTTLVNCPQNPSNRKKGRSKRARVLLASVEEATWNLLD
KGEKIAQEATVLKEELIGALEEVRKESEALKVSAERFADDPCYLPKREAVVQAARALLAA
VTRLLILADMIDVMCLLQHVSAFQRTFESLKNVSNKSDLQKTYQKLGKELENLDYLAFKR
QQDLKSPNQRDEIAGARASLKENSPILHSICSACLEHSDVASLKASKDTVCEEIQNALNV
ISNASQGIQNVLVPPEPQAATLGSALDELENLIVLDPLTVTEEETRPSLEKRLEAIISGA
ALLADSSCTRDFHRERIIAECNAIRQALQDLLSEYMNNTGKKERSNTLNIAIENMCKKTR
DLRRQLRKAIIDHVSDSFLDTTVPLLVLIEAAKNGREKEIKEYTAIFREHTSRLVEVANL
ACSMSTNEDGIKIVKVAANHLETLCPQIINAALALAARPKSQVVKKTMEMYRCTWENHIH
VLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAHIV
TGEMDSYEPGAYTEGVMRNVNFLTSTAIPEFVTQVNVALEALSKNSLDVFDDNQFVDISK
KIYDTIHDIRCSVMMIRTPEELEDVSDLEEDHEVRSHTSVQTEGKTDRAKMTQLPEAEKE
KIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTRGKGPLKHTTDV
IYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKICSQVKAEIQN
LGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGPRHPVVMWRMK
APAKKPLIKREKPEETYAAVRRGSAKKKIHPVQVMSEFRGRHIY
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggggacacttgcaggtggtttgagaacaaagttctgtgcattagtatccatcgtccca
acgggtaatgacacttcaattgcacttaaggaggaccacccctccccactggatgcaaac
ttacttcgcctgttaatcaaggcagtcatgtcagctgaaacatcaatcacactgaatgtc
aatcctcaggatctgcaggtccagacattcactgtagagaagctgctggagcctctcata
atccaggttactacacttgtaaattgtccccagaatccttccaacaggaaaaaaggacgt
tcaaaaagagccagagtccttctagcttctgtggaggaagcaacttggaatttattagac
aagggagagaagattgctcaagaagccacagttttaaaggaagagcttattggggccctt
gaggaagttcgcaaagaaagtgaagctctgaaagtatcagctgagagatttgcagatgat
ccctgttatctcccaaaaagggaggctgtggttcaagctgcccgtgccttgttggctgca
gttaccagactccttatcctcgcagatatgattgatgtcatgtgtctcttgcagcacgtg
tcagcttttcagaggacatttgagtctcttaaaaatgtttccaacaaatctgacctccag
aaaacctaccagaagcttgggaaggagctggaaaatctggactatttagccttcaaacgt
cagcaggacctaaaatctccaaatcagagggatgaaattgcaggtgcccgggcctcattg
aaggagaactcccccatactgcattcaatttgttcagcttgtttggaacattctgatgtc
gcttccctcaaagccagcaaggacacagtttgtgaagaaattcagaacgccctcaatgta
atttcaaatgcttcacaaggcatccagaatgtgttagtcccaccagaacctcaggcagca
accctgggaagtgcccttgatgagcttgagaatttaattgtcttggatccactcacagtg
actgaggaggaaacaagaccgtccctagagaaacgcctcgaagccattatcagtggggct
gctctgttggctgactcttcatgcacgagggatttccatcgggaacgaattatcgcagaa
tgcaatgccattcgccaggctctccaggacctgctttcagagtacatgaacaatactgga
aaaaaggaaaggagtaataccttgaatattgcaatagaaaacatgtgcaagaagacaaga
gaccttcgcagacagctccgtaaggctattatagatcatgtgtcagactcctttttggat
acaacagtcccacttttggttctcattgaagctgccaagaatggccgggaaaaggaaata
aaagaatatactgcgatatttcgtgaacacaccagcaggcttgtagaggtggcaaatctt
gcttgttccatgtcaacaaatgaagatggaattaagattgtcaaagttgcagccaatcac
ctggaaaccttgtgtccacagattattaatgctgcacttgctttggctgcaagacccaaa
agtcaagtggtcaaaaaaaccatggaaatgtacagatgcacgtgggagaatcatatccat
gtcctcactgaagctgtagatgacattacaagcattgatgacttccttgctgtatctgag
agccatatcctagaagatgtcaacaaatgtatcatagccttgagagaccaggatgctgat
aatttagatcgagctgcaggtgctatcagaggacgggccgcaagagttgctcacattgtc
acgggtgaaatggacagttacgagccaggagcttacacagaaggtgtgatgagaaatgtt
aacttcctgacaagtactgcaattccggaatttgtaacacaagtgaatgttgccttggaa
gccttaagtaaaaactctttggatgtgtttgatgataatcagtttgtggacatctcaaaa
aagatctatgatacaattcatgatatcagatgttcagtcatgatgattcggactccagag
gaactagaggatgtttctgacctggaagaagatcacgaggtccgcagtcacaccagtgtt
cagactgaagggaaaactgaccgggctaagatgactcaattgcctgaggcagaaaaggaa
aagatagctgagcaagttgctgatttcaagaaagtaaagagtaagctggatgctgagatt
gagatatgggacgatacgagcaacgatatcattgttctcgccaagaagatgtgtatgatc
atgatggagatgacagacttcacaaggggaaaaggaccactgaagcatacaactgatgtg
atctatgcagccaaaatgatatcagaatcaggatcaaggatggacgtccttgctcggcag
attgccaaccagtgcccagatccatcatgcaaacaggacttgttggcctacctggaacag
attaaattctactctcaccagctgaaaatctgcagtcaagttaaagctgagatccagaac
ctgggaggagagctcatcatgtcagcgttggacagtgtcacctccctgatccaagcagcc
aaaaatttaatgaatgctgtagtgcaaacagtgaaaatgtcttacattgcctcaaccaag
atcatccgaattcagagtcctgctgggccccggcacccagttgttatgtggagaatgaag
gctcctgcaaaaaaacccttgattaaaagagagaaaccagaggaaacgtatgcagctgtc
agacgaggctcagcaaagaaaaaaatccacccagtgcaagtgatgagtgaatttagagga
agacatatctactga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017413
Entry
103017413         CDS       T03086                                 

Gene name
CTNNA1
Definition
(RefSeq) catenin alpha 1
  KO
K05691  catenin alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04670  Leukocyte transendothelial migration
bacu05100  Bacterial invasion of epithelial cells
bacu05200  Pathways in cancer
bacu05213  Endometrial cancer
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    103017413 (CTNNA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103017413 (CTNNA1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103017413 (CTNNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017413 (CTNNA1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103017413 (CTNNA1)
   05213 Endometrial cancer
    103017413 (CTNNA1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103017413 (CTNNA1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103017413 (CTNNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103017413 (CTNNA1)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     103017413 (CTNNA1)
SSDB
Motif
Pfam: Vinculin Peptidase_C5
Other DBs
NCBI-GeneID: 103017413
NCBI-ProteinID: XP_007172293
UniProt: A0A383ZBM3
LinkDB
Position
Un
AA seq 906 aa
MTAVHAGNINFKWDPKSLEIRTLAVERLLEPLVTQVTTLVNTNSKGPSNKKRGRSKKAHV
LAASVEQATENFLEKGDKIAKESQFLKEELVAAVEDVRKQGDLMKSAAGEFADDPCSSVK
RGNMVRAARALLSAVTRLLILADMADVYKLLVQLKVVEDGILKLRNAGTEQDLGIQYKAL
KPEVDKLNIMAAKRQQELKDMGHRDQMAAARGILQKNIPILYTASQACLQHPDVAAYKAN
RDLIYKQLQQAVTGISNAAQATASDDASQHQGGGGGELAYALNNFDKQIIVDPLSFSEER
FRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYMGNAGRKER
SDALNSAIDKMTKKTRDLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYA
QVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLA
QENMDPFKERWEKQVRVLTDAVNDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDR
TAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSS
DPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTED
DQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMC
MIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYL
QRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVAS
TKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEF
KAMDSI
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgactgctgtccacgcaggcaacataaacttcaaatgggaccccaaaagtctagagatc
aggactctggcagttgaaagactgttggagcctcttgttacccaggttacaaccctggta
aacaccaatagcaaggggccctctaataagaagagaggtcgttctaagaaggcccatgtt
ttggctgcatctgttgaacaggcaactgagaatttcttggagaagggggataaaattgca
aaggagagtcagtttctcaaggaggagcttgtggctgctgtagaagatgttcgaaaacaa
ggtgatttgatgaagagtgctgctggcgagtttgcagatgatccctgctcttctgtgaag
cgtggcaacatggttcgggcagctcgagctttgctctctgctgttacccggctgcttatt
ttggctgacatggcagatgtctacaaattacttgttcagctgaaagttgtagaagacggt
atcttgaaactgaggaatgctggcactgaacaggacttgggaatacaatataaggccctg
aaacctgaagtggataagctgaacattatggcagccaaaagacaacaggaactgaaagat
atgggccatcgtgatcagatggctgcagccagaggaatcctgcagaaaaacattccaatc
ctctatactgcatcccaggcatgcctacagcaccctgatgtcgcagcctataaggccaac
agagacctgatatacaagcagctgcagcaggcggtcacaggcatttctaatgcagcccag
gctactgcatcagatgatgcctcccagcaccagggtggaggaggaggagagctggcatat
gccctcaataactttgataaacaaatcattgtggaccccttgagcttcagcgaggagcgc
tttaggccttccctggaggagcgcctggaaagcatcattagtggggctgccctgatggct
gattcatcgtgcacacgtgatgaccggcgtgagagaatcgtggcagagtgtaatgctgtc
cgccaggccttgcaggacctgctctcggagtacatgggcaacgctggacgtaaagaaaga
agtgatgcactcaattctgcaatagataaaatgaccaagaagaccagggacttgcgtagg
cagctccgcaaagctgtcatggaccatgtttcagattcatttctggaaaccaacgttcca
cttttagtattgattgaagctgcaaagaatggaaatgagaaagaagttaaagaatatgcc
caagttttccgtgaacatgccaacaaattaattgaggttgccaacttggcctgttccatc
tcaaacaatgaagaaggtgtaaagcttgttcgaatgtctgcaagccagctagaagccctc
tgtcctcaggttatcaatgctgcattggctttagcagcaaaaccacagagtaaactggcc
caagagaacatggatccttttaaagaacggtgggaaaaacaagtccgagttctcacagat
gctgtcaatgacattacttccattgatgacttcttggctgtctcagagaatcacattttg
gaagacgtgaacaaatgcgtcattgctctccaagagaaagatgtggatgggctggaccgc
acagctggtgcaattcgaggccgagctgctcgggtcattcacgtggtcacctcagagatg
gacaactatgagccaggggtctacacagagaaggtgctggaagccaccaagctcctctcc
aacacagtcatgccacgttttactgagcaagtggaagcggccgtggaagccctcagctcg
gaccccgcccagcccatggatgagaacgagtttatcgatgcctcacgcctggtgtacgat
ggcatccgggacatcaggaaagcggtgttgatgataaggacccctgaggagctggatgac
tcggacttcgagacggaagacttcgatgtcagaagcaggacaagcgtccagacagaagac
gatcagctgatagctggccagagtgcccgggcgatcatggctcagcttccccaggagcaa
aaagcaaagattgcggaacaggtggccagcttccaggaagaaaagagcaagctggatgcc
gaagtgtccaagtgggacgacagtggtaatgacatcatcgtgctggccaagcagatgtgc
atgatcatgatggagatgacggactttacccgaggtaaaggaccgctcaaaaacacatca
gatgtgatcagtgccgccaagaaaattgctgaggcgggatcccggatggataagcttggc
cgtaccatcgcagaccattgcccagactcagcctgcaagcaggacctgctggcctacctg
cagcgcatcgccctctactgccaccagctcaacatctgcagcaaagtcaaggctgaggtg
cagaacctcggtggggagctggtcgtctccggggtggacagcgccatgtccctgatccaa
gctgccaagaacttgatgaacgctgtggtgcagacagtgaaggcgtcctatgtggcctcc
accaaataccagaagtctcaggggatggcttcccttaacctccctgctgtgtcgtggaag
atgaaggcccctgagaaaaagcccttggtgaagagagagaaacaggatgagacacagacc
aagattaagagggcatctcagaagaagcatgtgaaccctgtgcaggccctcagcgagttc
aaagccatggacagcatctaa

DBGET integrated database retrieval system