KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008378Help
Entry
103008378         CDS       T03086                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium channel, voltage-dependent, R type, alpha 1E subunit
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04020  Calcium signaling pathway
bacu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008378 (CACNA1E)
   04020 Calcium signaling pathway
    103008378 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103008378 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bacu04040]
    103008378 (CACNA1E)
Ion channels [BR:bacu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103008378 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 103008378
NCBI-ProteinID: XP_007188324
LinkDB All DBs
Position
Un
AA seq 2311 aa AA seqDB search
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDERCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALGL
GLDKCEEEHVSRGGSLKGDGGDLSSALDNQRSPLSLGKREPPWLTRPCHGNCDPTQQEAG
GGETVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAVPGDGERDL
EPRDSHGGKEPTIQEEERSQDLRRTNSLMVSRGSGLAGALDEADTPLVLPQPELEVEKDA
ALAEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCVTANTDKAATESTSVTVAIPDVGP
LVDSTVVHISSKTDGEASPLKEAEIKEDEEEVEKQQQKKEKRETGKAMVPHSSMFIFSTT
NPIRRACHYVVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTF
EMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRV
LRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCT
DSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQ
HSVDVTEEDRGPSRSNRMEMSIFSLVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSL
EKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTIVLMMKY
YSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIIL
TDSKLVNTSGFNMSFFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYA
IIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDT
TAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLD
EFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMT
VHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASD
LTVGKIYAAMMIMDYYKQSKMKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQ
QDPSSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPSNHG
IYLPSDTQEHAGSGRASSMPRLTVDPQVVTEPSSMRRSFSTIREKRSNSSWLEEFSMERS
SENTYKSRRRSYHSSLRLSSHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNS
EERGTQADWESPERHQSRSPSEGRSQTPNRPGTGSLSESSIPSVSDTSTPRRSRRQLPPV
PPKPRPLLSYSSLLRHTGSISPPADGSEGGSPLTSQALEGNDASLPESSNPRYVHQGHPS
SPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGH
YRRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 6936 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggagatggagattcggac
cagagcaggaaccggcaaggaacccccgtgccggcctccgggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccctattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaactgcatcgtcttggccctggagcagcatcttcctgaggatgacaagaccccaatg
tcccgcagactggagaagacagaaccgtatttcatcgggatcttttgctttgaagctggg
atcaaaatcgtagccttggggttcatcttccataagggctcgtacctccgcaacggctgg
aatgtcatggacttcattgtggtcctcagtggcatcctggccactgcgggaacccacttc
aacacacatgtggacctgaggacgctccgggctgtgcgtgtcctaaggcccctgaagctc
gtgtcagggatacctagcttgcagattgtgttgaagtccatcatgaaggccatggtgcct
cttctgcagattggtcttctgctcttctttgccatcctgatgtttgctatcattggcttg
gagttctacagtgggaagttgcaccgagcttgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgatgggatcacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgtatcaccatggaagggtggaccaccgtgctgtacaataccaatgat
gccttaggagccacctggaattggctgtacttcatccccctgatcatcattggatccttc
tttgttctcaacctcgtcctgggagtgctttctggggaatttgccaaagagagagagaga
gtggagaaccggagagctttcatgaaactgcggcgccagcagcagatcgagcgtgagctg
aatgggtaccgcgcctggatagacaaagcagaggaagtcatgctcgctgaagaaaataaa
aatgctggaacgtcagccttagaagtgctccgaagggcaaccatcaaaaggagccggacg
gaggccatgacgcgggactccagcgacgagcgctgtgtcgacatctcctctgtgggcaca
cccctcgcccgagccagcatcaagagcacaaaggtggatggggcctcctatttccggcac
aaggagcggcttctgcgtatctctatccgccacatggttaaatcccaggtgttttactgg
attgtgctgagccttgtggctctcaacaccgcctgtgtggccatcgtccatcacaaccag
ccccagtggctcacccacctcctctactatgcagaatttttgtttctgggactcttcctc
ctggaaatgtccctgaagatgtacggcatggggcctcgcctttattttcactcttcgttc
aactgctttgattttggggtcacagtgggcagcatctttgaagtggtctgggcgatcttc
agacctggtacatcttttggaatcagtgtcttgcgagctctccggcttctaagaatattt
aaaataaccaagtactgggcatccctacggaatttggtggtctccttgatgagttccatg
aagtcaatcatcagtttgctcttccttctcttcctcttcatcgttgtctttgctctccta
ggaatgcagctgtttggaggcaggttcaactttaatgatgggactccttcagcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggtggggtcagctcaggcatgtggtcagct
atctatttcattgtgctcaccttgtttggaaactacacgctgctgaatgtattcttggcc
atcgctgtggacaatctggccaatgcccaggagctgaccaaggatgaacaggaagaagag
gaggccttcaaccagaaacacgcgctgcagaaggccaaggaggtcagcccgatgtctgcg
cccaacatgccttccatcgaaagagacagaaggagacgacaccacatgtcgatgtgggag
ccgcgcagcagccacctgagggagcgaaggcgccgacaccacatgtcggtgtgggagcag
cgcaccagccagctgagaaggcacatgcagatgtccagccaggaggccctcaacaaggag
gaggccccacccatgaaccccctcaatcccctcaaccccctgagccccctcaacccgctc
aatgcccaccccagcctctaccggagacccaggcccattgaggggctggccctgggactg
ggtctggacaagtgtgaggaagagcacgtcagccgcggggggtccctcaagggggacgga
ggggacctgtcgagtgccctggacaaccagaggagccccctgtccctgggcaaacgggag
ccgccctggctgaccaggccctgtcacgggaactgtgacccgacccagcaggaggccggg
ggcggggagaccgtggtgaccttcgaggaccgggccaggcacaggcagagccagcggcgc
agccggcaccgccgcgtcaggacggagggcaaggagtcctcctccgcttccaggagcagg
tctgccagccaggagcggagtctggatgaagctgtgcccggtgacggggagagggacctc
gagcccagggacagccacgggggcaaggagcccacaatccaggaagaagagcgatcccag
gacttaaggaggaccaacagtctgatggtgtccagaggctccgggctggcaggagccctc
gacgaggccgacacacccctcgtcctgccccaaccagagctggaagtggagaaggatgca
gcgctggcggagcaggagccggagggcagcagtgagcaagccctgctgggggacgtgcag
ctggacatgggccgggtcatcagccagagtgagcccgacctctcctgcgtcacagccaac
acggacaaggctgccaccgagagcaccagcgtcaccgtcgccatccccgacgtgggcccc
ttggtggactcgaccgtggtgcacatcagcagcaagactgatggagaagccagtcccttg
aaagaggcagagatcaaagaggatgaggaggaggtggagaagcagcagcagaagaaggag
aagcgtgagacgggcaaagccatggtgccccacagctcaatgttcatcttcagcaccacc
aacccgatccgcagggcctgccactacgtcgtgaacctgcgctactttgagatgtgcatc
ctcctggtgatcgcagccagcagcatcgccctggcggccgaggaccccgtcctgaccaac
tcggagcgcaacaaagtgctgaggtattttgactatgttttcactggcgtcttcaccttt
gagatggttataaagatgatagaccagggcttgatcctgcaggacgggtcctacttccga
gacctgtggaacatcctcgactttgtggtagtggttggtgcactggtagcctttgctctg
gcgaatgctttgggaaccaacaagggccgggacatcaagaccatcaagtccctgcgggtg
ctgcgtgtgctgagaccgctaaagaccatcaagcgcctgcccaagctcaaggctgtcttc
gactgtgtggtcacctccttgaaaaatgtcttcaacatactaattgtctataagctcttc
atgttcatctttgctgtcatcgcagttcaacttttcaagggcaagttcttctattgcaca
gacagttccaaggacacagagaaggagtgcataggaaactatgtagatcatgagaaaaac
aagatggaggtgaaaggccgagaatggaagcgccatgaattccactatgacaacatcatc
tgggccctgctgaccctcttcaccgtctccacaggggaaggatggcctcaagtgttgcag
cactctgtcgatgtgacagaggaagaccgaggcccgagccgcagcaaccgcatggagatg
tccatcttttctctggtctactttgtggtctttcctttcttcttcgtcaacatctttgtg
gctctcatcatcatcaccttccaggagcagggggacaagatgatggaagagtgcagcctg
gagaagaacgagagggcgtgcatcgacttcgccatcagtgccaaaccgctcacccgctac
atgccccagaacaggcacaccttccagtaccgcgtctggcacttcgtggtgtctccatcc
tttgagtacaccatcatggccatgatcgccctgaacaccatcgtgctgatgatgaagtac
tactctgctccctgtacctatgaactggccctgaagtacctgaatatcgccttcaccatg
gtgttttccctggaatgtgtcctaaagatcattgcgtttggcttcttgaactatttccga
gacacctggaatatctttgacttcatcaccgtgatcggcagtatcacagaaattattttg
acagacagcaagctggtgaacaccagtggcttcaatatgagctttttccgagccgcccgc
ctcatcaagcttctgcgtcaaggatacaccatccgtattttactttggaccttcgtgcag
tcctttaaggccctcccctacgtctgccttctgattgccatgcttttcttcatctatgcc
atcattgggatgcaggtctttggaaacataaaattagatgaggagagtcacatcaaccgg
cacaacaacttccggagtttctttgggtccctcatgctactcttcaggagtgccacgggc
gaggcctggcaggagataatgctgtcgtgcctcggggagaagggctgtgagcctgacacc
accgcaccatcggggcagagcgagagcgagcgctgtggcactgacctggcctacgtgtac
ttcgtctccttcatcttcttctgttccttcttgatgctcaacctgttcgtggccgtcatc
atggacaactttgagtacctgactcgggactcatccatcctggggcctcaccacctggac
gagtttgtccgtgtctgggcagagtatgacagagcggcatgtggccgcatccattacact
gagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaagagatgtccc
tccaaggtggcatataagaggttagtcctgatgaatatgccagtggctgaggacatgact
gtccacttcacttccacgcttatggctctgatccggacagctctggacattaaaatcgcc
aaaggtggtgcggacaggcagcagctagactcagagctacagaaggagaccctggccatc
tggcctcacctgtcccagaagatgttagatctgcttgtgcccatgcccaaagcctccgac
ctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataaacagagcaag
atgaagaagcagaggcagcagctggaggaacagaaaaacgcacccatgttccagcggatg
gagccgtcatctctgcctcaggagatcattgctaatgccaaagccctgccttatctccag
caggaccccagttcaggcctgagtggccggagtggatacccttcgatgagtccactctcc
ccgcaggaaatattccagttggcctgtatggacccagctgatgatggacaattccaggaa
cagcaatctctggagccagaggttagtgaattaaaaagcgtgcagccctctaaccatggc
atctaccttccttcggacacccaggagcatgcgggatctgggagggcatcctctatgcca
cgcctgactgtggatccccaggtggtgacagaacctagctccatgagacgttcattttcc
actattcgggaaaagcgttcaaattcctcttggctggaggaattctccatggagcgaagc
agcgaaaacacctacaagtcgcgtcgccggagttaccactcctccctgaggctgtcatcc
caccgcctgaactctgactcaggccacaagtccgacacccaccgctcagggggcagagag
cggggacgatcaaaagagcgaaagcatcttctctctcccgatgtgtcccgctgcaactcc
gaggagcgagggacccaggccgactgggagtccccagaacgtcatcagtcccggtctccc
agcgagggcaggtcacagacccccaacagaccgggcacagggtccctcagtgaaagctcc
atcccctccgtctctgacaccagcaccccaagacgaagtcgtaggcagctcccacccgtc
cctccaaagcctcggcccctcctttcctacagctccctgctgagacacactgggagcatc
tccccacctgctgatgggagcgagggcggctccccactgacttcccaagctctggagggc
aatgacgccagcctgcccgagtcttccaacccccggtacgtacatcagggccacccctcc
tccccacagcgctacatctctgagccctacctggccctgcacgaagactcccacgcctcg
gactgtggcgaggaggagacgctcacctttgaagcagctgtggctaccagcctcggccgg
tccaacaccatcggctcagccccgcccctgcggcacagctggcagatgcccaatgggcac
tatcggcggcggaggcgcggggggcctggaccaggcgtgatgtgtggagctgtcagcgac
cttctgagtgatacggaagaagacgacaaatgctag

DBGET integrated database retrieval system