KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008462
Entry
103008462         CDS       T03086                                 

Gene name
FLT3
Definition
(RefSeq) fms related tyrosine kinase 3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04640  Hematopoietic cell lineage
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05221  Acute myeloid leukemia
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008462 (FLT3)
   04014 Ras signaling pathway
    103008462 (FLT3)
   04151 PI3K-Akt signaling pathway
    103008462 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103008462 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008462 (FLT3)
   05202 Transcriptional misregulation in cancer
    103008462 (FLT3)
   05230 Central carbon metabolism in cancer
    103008462 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103008462 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103008462 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bacu04090]
    103008462 (FLT3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103008462 (FLT3)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103008462 (FLT3)
CD molecules [BR:bacu04090]
 Proteins
  103008462 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 Ig_2 I-set APH
Other DBs
NCBI-GeneID: 103008462
NCBI-ProteinID: XP_007164336
UniProt: A0A383YNL9
LinkDB
Position
Un
AA seq 1074 aa
MTPPPNLEAELDVWGQVDYFNAFSVELMGLWVARGIVQYQKNPRQSFTGKVLFVFRDKAS
MKPIQKKLLIVQTFLYNQKTARVYLFPSRLVSRFTVVFSAMIFETITNQDLPVIKCVLIN
HRNNDSSVGTSSSNPLASESREDLGCALRPESTEAVYEASTVEVDITASITLQVLVTTPG
NISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTVLFTVS
IRNTLLYTLRRPYFRKMENQDALVCISESIPEPTVEWVFCDSQSDSCKGESPAVITKEES
VLHELFGTDIRCCARNELGRECTKLFTIDLNQTPQTTPPQLFLKVGEPLWIRCKAVHVNH
GFGLSWELENKTLEEGSYFEMSTYSTNRTMIRILFAFVSSVGRNDTGYYTCSSSEHPSKS
ALVTILEKGFINASKSSEDYEIDQYEEFCFSVRFKAYPQIRCTWSFSRKSFPCEQSGLDD
GYSISKFCNHKHQPGQYIFHAENDDAQFTKMFTLNIRRKPQVLAEASASQASCSSDGYPL
PSWTWKKCSDKSPNCTEEITEGIWNKKANRKVFGQWISSSTLNMSEAVKGFLVKCCAYNS
LGTSCETILLNSPGRFPFIQDNISFYATIGLCLPFIAVLTMLICHKYKKQFRYESQLQMV
QVTGSLDNEYFYIDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSI
QVAVKMLKEKADSSEREALMSELKMMTHLGSHENIVNLLGACTLSGPIYLIFEYCCYGDL
LNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSPPNSSMPGSREVQIHPDSDPVSGFNGNS
FQSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLV
THGKMVKIGDFGLARDIMSDSNYVIRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLW
EIFSLGVNPYPGIPADAKFYKLIQSGFKMDQPFYATEEIYFIMQSCWAFDSRKRPSFPNL
TSFLGCQLADAEEAMYQNVDGHVLERPSVYQNRRPYSREVDSGLPSPRAHVEDS
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgacccccccccccaatctagaggctgaattagatgtttgggggcaagtagactacttc
aacgccttcagtgttgaactcatggggctctgggtggctaggggcattgtccagtatcaa
aagaacccaaggcagtcctttacgggcaaggtactttttgtcttcagggacaaagcatcg
atgaaaccaatccagaaaaagttactcattgtccagaccttcttgtacaaccaaaagaca
gctcgtgtttatcttttcccttcaaggctagttagcagatttacagttgttttttccgca
atgatatttgagactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaac
catagaaacaatgattcatcagtggggacatcatcatcgaatcccttggcatcagaatcc
cgggaagacctgggctgtgccttgaggcccgagagcacagaggcagtgtatgaagcgtcc
actgtggaggtggacataactgcatccatcacactgcaagtgctggtcaccaccccgggg
aacatttcctgtctctgggtctttaaacacagctccctgaattgccagccacactttgat
ttacaaaacagaggagttgtctccatggtcattttgaaaatgacagaaacccaggctgga
gaatacctactttttattcagagtgaagctaccaattacacagtcttgtttacagtgagt
ataagaaataccctgctttacacattaaggagaccttactttagaaaaatggaaaatcag
gatgccctggtctgcatctcggagagcattccggaaccaaccgtggaatgggtgttctgt
gattcacagagcgacagctgtaaaggagaaagtccagctgtcattacaaaggaagaaagt
gtactccatgagttatttggaacagacataaggtgctgtgcaagaaatgagctgggcagg
gaatgtacgaaactcttcactattgatctaaaccaaactcctcagaccacaccgccacaa
ttatttcttaaagtaggggaacccttatggataaggtgcaaagctgttcatgtaaaccac
ggattcgggctcagctgggaattagagaataaaacactggaagagggcagctactttgag
atgagtacctattccacaaacagaactatgatacggattctgtttgcttttgtatcatca
gtgggaagaaacgacactggctattacacttgttcctcttcagaacatcccagtaaatca
gctttggtcaccatcctagaaaagggatttataaacgcttccaaatcaagtgaagattat
gaaattgaccagtatgaagagttttgtttttctgtcaggtttaaagcatacccacaaatc
agatgtacgtggagcttctctcgaaaatcatttccttgtgagcaaagtggcctggatgac
gggtacagcatatctaagttttgcaaccataaacaccagccaggacaatatatcttccat
gcagaaaatgatgacgcccagttcacaaaaatgttcacactgaatataagaaggaaacct
caagtgctcgccgaggcatcggcaagtcaggcttcttgctcctctgacgggtacccgtta
ccgtcttggacctggaagaagtgttcagacaagtctcccaactgcacagaagagatcaca
gaaggaatttggaataaaaaggccaacagaaaagtatttggacagtggatatcgagcagc
accctgaacatgagcgaggctgtcaaagggttcctggtgaagtgctgtgcatacaattcc
ctcggcacctcttgtgaaacaatccttctaaactcaccaggtcgcttccctttcatccag
gacaacatctcattctatgcaacaattggcctctgtcttccctttattgctgttttaacc
atgctaatttgtcacaagtacaaaaagcaatttcggtacgaaagccagctacagatggtg
caggtgaccggctctctggataatgagtacttctacattgatttcagagaatacgaatat
gatctcaaatgggagtttccaagagaaaatttagaatttgggaaggtcctgggatcgggt
gcttttgggaaagtgatgaatgcaaccgcctatggaatcagtaagacaggggtctcaatc
caggtcgcagtcaaaatgctgaaagagaaagcagacagctcggaaagagaggcgctcatg
tctgaactcaaaatgatgacccacctaggcagccatgagaatattgtgaatctgctgggg
gcgtgcaccctgtcaggaccaatttacttgatttttgaatattgttgctatggcgacctt
ctcaactatctaagaagtaaaagagaaaaatttcataggacgtggacggagattttcaag
gaacataatttcagtttttatcccactttccaatcaccccctaattccagtatgcctggt
tcaagagaagtccaaatacacccggactcagatcctgtctcagggttcaatgggaattca
tttcaatcagaagatgaaattgaatacgaaaaccaaaaaaggctggaggaagaagaggac
ttgaatgtacttacctttgaagatcttctttgctttgcatatcaagtggccaaaggaatg
gaatttctggaatttaagtcgtgtgttcacagagacctggcagccaggaatgtccttgtg
acccacgggaaaatggtgaagatcggtgattttggactggctcgggacattatgagtgat
tccaactacgtgatcagaggcaatgcccgtctgcctgtgaagtggatggctcctgaaagc
ttgtttgaggggatctacacaattaagagcgatgtctggtcatacggaatattactctgg
gaaatattctcgcttggtgtcaatccttaccccgggattccagctgatgctaaattctac
aaactcatccagagtggatttaaaatggatcagccattttatgccacggaagaaatatac
tttataatgcaatcctgctgggcttttgactcaaggaaacggccatcctttcctaacctg
acttcatttttaggatgtcagctggcagatgcggaagaagcgatgtatcagaacgtggat
ggccatgttttggaacgtccttctgtttaccaaaacaggcgaccttacagcagagaggtg
gactcagggctaccctctccacgggctcacgttgaagattcctag

DBGET integrated database retrieval system