KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008558
Entry
103008558         CDS       T03086                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01523  Antifolate resistance
bacu04060  Cytokine-cytokine receptor interaction
bacu04061  Viral protein interaction with cytokine and cytokine receptor
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04640  Hematopoietic cell lineage
bacu04657  IL-17 signaling pathway
bacu04659  Th17 cell differentiation
bacu04668  TNF signaling pathway
bacu04672  Intestinal immune network for IgA production
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05010  Alzheimer disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05134  Legionellosis
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05143  African trypanosomiasis
bacu05144  Malaria
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
bacu05332  Graft-versus-host disease
bacu05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103008558 (IL6)
   04668 TNF signaling pathway
    103008558 (IL6)
   04066 HIF-1 signaling pathway
    103008558 (IL6)
   04068 FoxO signaling pathway
    103008558 (IL6)
   04151 PI3K-Akt signaling pathway
    103008558 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103008558 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103008558 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103008558 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103008558 (IL6)
   04620 Toll-like receptor signaling pathway
    103008558 (IL6)
   04621 NOD-like receptor signaling pathway
    103008558 (IL6)
   04623 Cytosolic DNA-sensing pathway
    103008558 (IL6)
   04625 C-type lectin receptor signaling pathway
    103008558 (IL6)
   04659 Th17 cell differentiation
    103008558 (IL6)
   04657 IL-17 signaling pathway
    103008558 (IL6)
   04672 Intestinal immune network for IgA production
    103008558 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008558 (IL6)
   05202 Transcriptional misregulation in cancer
    103008558 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103008558 (IL6)
   05321 Inflammatory bowel disease
    103008558 (IL6)
   05332 Graft-versus-host disease
    103008558 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103008558 (IL6)
   05020 Prion disease
    103008558 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    103008558 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103008558 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103008558 (IL6)
   04931 Insulin resistance
    103008558 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103008558 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103008558 (IL6)
   05135 Yersinia infection
    103008558 (IL6)
   05133 Pertussis
    103008558 (IL6)
   05134 Legionellosis
    103008558 (IL6)
   05152 Tuberculosis
    103008558 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103008558 (IL6)
   05161 Hepatitis B
    103008558 (IL6)
   05171 Coronavirus disease - COVID-19
    103008558 (IL6)
   05164 Influenza A
    103008558 (IL6)
   05162 Measles
    103008558 (IL6)
   05168 Herpes simplex virus 1 infection
    103008558 (IL6)
   05163 Human cytomegalovirus infection
    103008558 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103008558 (IL6)
   05169 Epstein-Barr virus infection
    103008558 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103008558 (IL6)
   05144 Malaria
    103008558 (IL6)
   05142 Chagas disease
    103008558 (IL6)
   05143 African trypanosomiasis
    103008558 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103008558 (IL6)
   01523 Antifolate resistance
    103008558 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103008558 (IL6)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interleukins
   103008558 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL23 Mod_r FtsH_ext
Other DBs
NCBI-GeneID: 103008558
NCBI-ProteinID: XP_007183991
UniProt: A0A384A9F1
LinkDB
Position
Un
AA seq 208 aa
MNSLSTIAFSLGLLLVMTTAFPXXGPLGEDFKDDTTSGRLLLTSPDKTEALIKYILGKIS
AMRKEMCEKYDKCENSKEALAENNLNLPKMAEKDGCFQSGFNQETCLMRVTTGLLEYQIY
LDYLQNEYEGDKGSIEAVQISIKALVQILRQKVKNPDEVTTPDPTTNASLLNNLQSQNDD
WMKNTKIILILRSLENFLQFSLRAIRIK
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaatcgccttctccctggggctgctcctggtgatgactactgct
ttcccnnnnnngggacccctgggcgaagatttcaaagatgataccacttcaggcagacta
ctcctcacctctccagacaaaactgaagctctcattaagtacatcctcggcaaaatctct
gcaatgagaaaggagatgtgtgagaagtatgacaagtgtgaaaacagcaaggaggcactg
gcagaaaacaacctgaaccttccaaaaatggcagaaaaagacggatgcttccaatctggg
ttcaatcaggagacttgcttgatgagagtcaccaccggtcttctggagtatcagatatac
ctggactacctccagaacgagtatgagggcgataagggaagcatcgaggctgtgcagatt
agtatcaaagcactggtccagatcctgaggcaaaaggtaaagaatccagatgaagtaacc
acccctgacccaactacaaatgccagcctgctgaataatctgcagtcacagaacgatgac
tggatgaagaacacaaagattatcctcatcctgcgaagccttgagaatttcctgcagttc
agcctgagggctattcggataaagtag

DBGET integrated database retrieval system