KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008626
Entry
103008626         CDS       T03086                                 

Gene name
BCL6
Definition
(RefSeq) B-cell CLL/lymphoma 6
  KO
K15618  B-cell lymphoma 6 protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103008626 (BCL6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103008626 (BCL6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103008626 (BCL6)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    103008626 (BCL6)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-C2H2_jaz DZR zf-C2HE zf-H2C2_5 zf-C2H2_11 zf-C2H2_6 DUF3342 Zn-ribbon_8
Other DBs
NCBI-GeneID: 103008626
NCBI-ProteinID: XP_007195289
UniProt: A0A384B6K3
LinkDB
Position
Un
AA seq 706 aa
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVPAMKPPREDFLNSRMLMPQDLMAYRGREVVENSLPLRGAPGCESRAF
APSLYNGLSTPPASYPVYGHLPVSSFLFSDEELRDARMPVANPFPKERTLPCDSARPVPS
EYSRPAMELSPTVGHNNVYSPKEAALEEARSDMHYSVAEGPKPAAPSARSAPYFACDKAG
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQTSG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
ETLDLQSPTKLSTNGEDSTIPQASRLNNIVNRSLTGSPRSSSESHSPLYLHAPKCTSCGS
QSPQHAEMCLHATGPTFPEELGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHMLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcctcgccggctgacagctgtatccagttcacccgccatgccagtgacgttcttctc
aaccttaatcgcctccggagccgcgacatcttgacggatgttgtcatagtggtgagccgg
gagcagttccgagcccataagacggtcctcatggcctgcagtggcctgttctacagcatc
ttcacagaccagctgaaatgcaacctcagtgtgatcaacctggatcctgagatcaacccg
gaggggttctgcatcctcctggacttcatgtacacgtctcggctcaatctgcgggagggc
aacatcatggccgtgatggccacagctatgtacctgcagatggagcatgttgtggacact
tgccggaagttcatcaaggccagtgaagcagagatggtccctgccatgaagcctccccgt
gaagacttcctgaacagccggatgctgatgccccaagacctcatggcctatcggggccgg
gaggtggtggagaacagcctgcccctgaggggcgcccctggctgtgagagcagagccttc
gcccccagcctgtacaacggcctgtccacgccgccagcctcgtaccccgtgtatggccac
cttccggtcagcagcttcctcttctccgacgaggagctgcgggacgcccggatgcctgtg
gccaaccccttccccaaggagcggaccctcccctgcgacagcgccaggccagtccccagt
gagtacagtcggccggccatggagctgtcccccactgtgggccacaacaacgtgtactca
cccaaggaggcagccctggaggaggcacggagtgacatgcactacagtgtggccgagggc
cccaagcctgccgccccctcggcccggagcgccccatacttcgcctgtgacaaggccggc
aaagaggaagagaggccctcgtcggaggatgagattgccctgcatttcgagccgcccaat
gcacccctgaaccggaagggtctggttagcccgcagagcccccagaagtccgactgccag
cccaactcgcccacggagtcctgcagcagcaagaacgcctgcatcctccagacctccggg
tcccctccggccaaaagccccactgaccccaaagcctgcaactggaagaagtacaagttc
atcgtgctcaacagcctcaaccagaatgccaaaccagaggggcccgagcaggccgagctg
ggccgcctttcccctcgagcctacactgccccgccggcctgccagccgcccatggagccc
gagacccttgacctccagtccccaactaagctcagcaccaatggggaggactccaccatc
ccacaggccagcaggctcaataacatcgtcaacaggtccctgaccggctccccacgcagc
agcagtgagagccactctccgctctacctgcacgcccccaagtgcacgtcctgtggctct
cagtccccgcagcacgcagagatgtgcctccacgccactggccccacgttccccgaggag
ctgggcgagacccagtccgagtactcagattccagctgcgagaatggggccttcttctgc
aatgagtgtgactgccgcttttctgaggaggcctccctcaagaggcatatgctgcagacc
cacagtgacaaaccctacaagtgtgaccgctgccaggcctcctttcgctacaagggcaac
ctcgccagccacaagaccgtccacacgggtgagaaaccctatcgctgtaacatctgcggg
gcccagttcaaccggccagccaacctgaaaacccacacccgaattcactccggagagaag
ccctacaagtgcgaaacgtgcggagccagatttgtccaggtggcccacctccgtgcccac
gtgctcatccacactggcgagaagccctatccctgtgaaatctgtggcacccgtttccgg
caccttcagactctgaagagccacctgcgaatccacacgggagagaaaccttaccattgt
gagaaatgtaacctgcatttccgtcacaaaagccagctgcgtcttcacttgcgccagaag
cacggtgccatcaccaacaccaaagtgcaataccgtgtgtccgccactgacctgcccccg
gagctccccaaagcctgctga

DBGET integrated database retrieval system