KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008665
Entry
103008665         CDS       T03086                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04915  Estrogen signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103008665 (NCOA3)
   04919 Thyroid hormone signaling pathway
    103008665 (NCOA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008665 (NCOA3)
  09162 Cancer: specific types
   05224 Breast cancer
    103008665 (NCOA3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103008665 (NCOA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103008665 (NCOA3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103008665 (NCOA3)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103008665 (NCOA3)
SSDB
Motif
Pfam: NCOA_u2 DUF4927 SRC-1 PAS_11 DUF1518 Nuc_rec_co-act PAS PAS_3 PAS_9 HLH PAS_2 PAS_4
Other DBs
NCBI-GeneID: 103008665
NCBI-ProteinID: XP_007185406
LinkDB
Position
Un
AA seq 1406 aa
MSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNREGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVTWTNETQRQKSHTFNCRMLMKIPHDILEDINTNPEMRQKYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERALPSHPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRPNPNPVGQGIRPPAAGCNSSVGSVNMSPNPGLQMLSSRTYGL
AEPGTTGQMTGARYGPSGSIASMNPGPGMQSPSSYQNSNYGLNMSSPPHGSPGLGSSQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDNSPNMNVSQPSKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHLNDKESK
ESSVEGPENQRGPLESKGHKKLLQLLTCSSEDRGHSSLTNSPLDSSCKDSSISVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSTTSCVEG
NVKQEQLSPKRKENNALLRYLLDRDDPSDTLSKELQPKVEGGVDGKVSQCSSSTIPSSSQ
GKDAKIKTETNEEGSGDLDNLDAILGDLTNSDFYNNSISTNGSNLVTKQQMFQGTNSLGL
RSPQSVQSVRPPYNRAVSLDSPVSVGSSPPVKNIGAFPMLPKQPMLGGNPRMMDSQENYG
SNMGGPNRNVTVNQTPSSGDWGLPNSKASRMEPMNSNSMGRPGTDYNASLPRPAVGGSVP
AVPLRSGSIPGVRPVLQHQQQQQMLQMRPGEIPMGMGVSPYGQAAPSNQPGSWPDGMLSM
EQGPHGTQNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALG
XXXVNQGQALESKQDAFQAQEAAVMMEQKAALYGQTYPTQGPPVQGGFHLPGQSPPFNSM
MNQMNQQGGFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALEMKMENP
TAGGAAVMRPMMQPQVNSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQAQ
AFSPPPNVTASPTMDGVLAGPAMPQAPPQQFPYPPNYGMGQQPDPAFGRVPSPPNAMISS
RMGPSQNPMMQHPQTAPMYQSSEMKGWPSGTLTRNSSFSQQQFAHQGNPAAYSMVHMNGS
SGPMGQMNMNSMPMTGMPMGPDQKYC
NT seq 4221 nt   +upstreamnt  +downstreamnt
atgagcggattaggagaaaactccttggatccactggcccctgattcacgaaaacgcaag
ttgccatgtgatactccaggacaaggccttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatatattgaagaattggctgaactgatatctgctaatcttagtgatatt
gacaatttcaatgtcaaaccagataaatgtgcaattttaaaggaaacagtaagacagata
cgtcaaataaaagagcaaggaaaagctatttccagtgatgatgatgttcagaaagctgat
gtatcttccacaggacaaggagttattgataaagactccttaggaccacttttacttcag
gcattggatggcttcctgtttgtggtgaatcgtgaaggaaacattgtatttgtgtcagaa
aatgtcacccagtacctgcaatataagcaagaggacctggttaacacaagtgtctacaat
atcttgcatgaagaagacagaaaggattttcttaaaaacttaccaaaatctacagttaat
ggagttacctggactaatgagacccagcgacaaaaaagccatacatttaattgccgtatg
ttgatgaaaataccacatgacattctggaagacataaacactaatcctgaaatgcgccag
aaatatgaaacgatgcagtgctttgccctgtcccagccacgggctatgatggaggaagga
gaagatttgcagtcctgtatgatctgtgtggcacgtcgcattaccacaggagaaagagca
ttgccgtcacatcctgagagctttattactagacatgatctttcaggaaaagttgtcaac
atagatacaaattcactgagatcttccatgaggcctggttttgaagatataatccgaagg
tgtatccagagattttttagtcttaatgatgggcagtcatggtcccagaaacgtcactat
caagaagcttatatccatggccatgcagaaaccccagtgtatcgattctctttggctgat
ggcactatagtgactgcacaaacaaaaagcaaactctttcgaaatcctgtaacaaatgat
cgtcacggctttgtctcaacccactttcttcagagggaacagaatgggtatagaccaaac
ccaaatcctgttggacaaggcattagacctccagcggctggatgcaacagttcggtaggc
agcgtgaacatgtcgccaaacccaggcttgcagatgctgagcagcaggacctacggcttg
gctgagcccggcaccacggggcagatgactggagccaggtatgggccttccggtagcata
gcttcaatgaaccctgggccaggcatgcagtcaccatcttcctaccagaacagcaactat
ggtctcaacatgagtagccctccacatgggagtcctggtcttggctccagccagcagaat
attatgatttctcctcgtaatcgtgggagtccaaagatggcctcacatcagttttctcct
gttgcaggtgtgcactctcccatgggatcttctggcaatactgggagtcacagcttttct
agcagctctctcagtgcccttcaagctatcagtgagggagtagggacttctcttttatct
actctgtcttcaccaggtcccaaattggataactctcccaatatgaatgtaagtcaacca
agtaaagtgaacagtcaagattccaagagtcccctaggcttgtattgcgaccagaatcca
gtggagagttcaatgtgtcagtcaaatagcagagatcacctcaatgacaaagaaagtaag
gagagcagtgtggaagggccagagaatcagcggggtcctctggaaagcaaaggtcacaaa
aaattactacagttacttacctgttcttctgaggaccggggtcattcctccttgaccaac
tcgcccctggattcaagttgtaaagactcttccattagtgtcaccagcccctctggggtc
tcctcttcgacgtctggaggagtgtcctccacatccaatatgcacgggtcactgctgcaa
gagaagcaccggattttgcacaagttgctgcagaatgggaattcaccggctgaggtagcc
aagattaccgccgaagccactgggaaagacactagcagtacaacgtcttgtgtagaagga
aacgtcaagcaggagcaactaagccctaagagaaaggaaaataatgctctgcttaggtat
ctgctggacagggatgatcctagtgacacgctctccaaagaactacagcccaaagtggaa
ggtggcgtagacggtaaagtgagccagtgcagcagctccaccatcccgagctcaagtcaa
gggaaggacgctaaaattaagacagaaacaaatgaagagggatctggagacttggataat
ctagatgctattcttggtgatctgactaattctgacttctacaataattccatatccaca
aatggtagtaatctggtaacgaagcaacaaatgtttcaaggaactaattctctgggtttg
aggagtccacagtctgtgcagtctgttcgtcctccatataaccgagcagtgtctctagac
agccctgtttccgttggctcaagccctccagtaaagaatattggtgctttccccatgtta
ccaaagcaacccatgttgggtggcaacccaagaatgatggatagtcaggaaaattatggc
tcaaacatgggtggaccaaacagaaatgtgactgtgaatcagactccttcctcgggagac
tggggcttaccaaactcaaaggccagccgaatggaacctatgaattcaaactccatgggg
agaccaggaacggattataacgcttctttacccaggcctgccgtgggtggctcagtgccc
gccgtgcctcttcggtccggtagcatcccaggtgtgaggccagtgttgcagcatcagcag
cagcagcagatgcttcagatgcggcccggtgagattcccatggggatgggggtcagtcct
tacggccaagcagcaccatcgaaccaacctggttcctggccagatggcatgttgtccatg
gaacaaggccctcatgggactcaaaataggccacttcttaggaattccctggatgatctc
cttgggccaccttctaaccttgaaggccagagtgacgaaagagcattgttggaccagctg
cacacactcttgagcaacacagatgccacaggcctggaagaaattgacagagctcttggn
nnnnnnnntgtaaatcaaggacaagctttggagtccaaacaggatgctttccaagcccaa
gaagcggcagtaatgatggagcagaaggcggcattatatgggcagacgtacccgacacag
gggcctccagtgcaaggaggctttcatcttccgggacaatctccaccttttaactcgatg
atgaatcagatgaaccagcaaggcggttttcctctccaaggaatgcacccccgggccaac
atcatgagaccccggacaaacactcccaagcaacttagaatgcagcttcagcagaggctg
cagggccagcagtttttgaatcagagccgtcaggcacttgaaatgaaaatggaaaacccc
actgctggtggggctgcggtgatgaggcccatgatgcagccccaggtcaactcccagcag
ggtttccttaacgcccagatggtcgcccagcgcagcagagagctgctgagtcatcacttc
cgacagcagagggtggcgatgatgatgcagcagcagcagcaacagcagcagcaagcccag
gccttcagtccaccccctaacgtgactgcgtcccccaccatggatggagtcctggcaggg
cctgccatgccacaggctccaccccagcagtttccatatccaccaaattacgggatggga
caacagccagatccagcctttggccgagtgcctagtcctcccaatgcgatgatatcatca
agaatgggtccctcccagaatcccatgatgcagcaccctcagaccgcacccatgtatcag
tcctcggaaatgaagggctggccgtcaggaaccctgaccaggaacagctctttttcccag
cagcagtttgcccaccaggggaatcctgcagcatatagtatggtgcacatgaatggcagc
agtggtcccatgggacagatgaacatgaactccatgcccatgactggcatgccgatgggt
cctgatcagaaatattgctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020002
Entry
103020002         CDS       T03086                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04915  Estrogen signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103020002 (NCOA1)
   04919 Thyroid hormone signaling pathway
    103020002 (NCOA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020002 (NCOA1)
  09162 Cancer: specific types
   05224 Breast cancer
    103020002 (NCOA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103020002 (NCOA1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     103020002 (NCOA1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    103020002 (NCOA1)
SSDB
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_12 PAS_4
Other DBs
NCBI-GeneID: 103020002
NCBI-ProteinID: XP_007191311
UniProt: A0A384AV84
LinkDB
Position
Un
AA seq 1441 aa
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNPGMSIPRVNPSVNPSISPAHGAARSATLPPSNNNVVSTRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVSMTSTACNNSNRSYSNIPVTP
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPNRLNIQPAKAESKDNKEIASILNEMIQSDN
SSNDGKPLDSGLLHNSDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTPSSASASSSTGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVA
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPAPMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCETERMDGAV
TTVAIKSEILPAALQTTTARPTSRLNRLPELELEAIDNQFGQPGSGDQVSWTNNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQTRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPSYGTNPGTPPASTSPFSQLAANPEATLAN
RNSMVNRGMTGNMGGQFGTGISPQMQQNVFQYPGSGMVPQGEANFSPSLSPGSSMVPMPI
PPPQSSLLQQTPPTSGYQSPDMKAWQQGAMGNSNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt   +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatctgaccctgctaacccagactcacataagagaaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttagaagagctagccgagttattgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagatattgaagaagacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtacagaagtcagacatctcg
tcgagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagaaaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtgggtgatcatgcggaatttgtgaagaatctgctaccaaaatcgctagtaaatgga
gttccttggcctcaagaggcaacacgacgaaacagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcaccgagaaccaggaagcttgccagcggtatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtttgatttgtattgcacggagattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggctgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcaaggcagagagccatcttatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaatcctgga
atgtcaattccccgggtaaacccttccgtcaatcctagtatctctccagctcacggcgcg
gcccgttcagctacattgccaccatccaacaacaacgtggtatccaccagagtaaaccgc
caacagagctcagaccttcatagcagcagtcacagtaattctagcaacagccaagggagt
tttggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaatccctctttaaacctcaataattctcctatggaaggtacagga
atatcccttgcacagttcatgtctccaaggagacaagttagttctggattggcaacaagg
cccaggatgccaaacaattcatttcctcctaatattccgacattaagctcccccgttagc
atgacaagtactgcctgtaataatagtaaccgatcttattcaaacatcccggtaacacct
ttacagagtatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctaacagattaaatatacagccagcaaaagct
gaatccaaagataataaagagatcgcgtccattttaaatgaaatgattcagtctgacaac
agctctaatgatggcaaacctctggattctgggcttctgcataacagtgacagactctca
gatggagacaataaatactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gcagagcagcagttacggcatgctgatatagacacaagttgcaaagaggtactgtcctgc
acaggcactcccagctctgcctctgctagctcttcaactggttcttgcccttcctctcat
agctcactgacagagcggcacaaaatcctacaccggctcttacaggagggtagcccctcg
gatatcacaactttgtctgtggagcctgataaaaaggacagtgcatctacttctgtggca
gtgactggacaggtacaagggaactccagtataaagctggaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgctaccttttagataaagatgagaaagattta
agatccactccaaacctgagcctggatgacgtaaaggtgaaggtggaaaagaaagaacag
atggatccttgtaacacaaatccagccccaatgaccaaacctgctcctgaggaaattaaa
ctggagtcacagagccagtttacagctgaccttgaccagtttgatcagttactacccacg
ctggagaaggccgcacagttgccaggcttatgtgagacagagaggatggatggtgcggtc
accactgtagccatcaaatcggagatcctgccagctgcacttcagaccaccactgccaga
cccacttccaggctgaatagattacctgagctggaattggaagcaattgataaccagttt
ggacaaccaggaagtggtgatcaggtttcatggacaaataatacagtgacagctgtaaat
cagaataagccagaggaccagtgcattagttcacagttagatgagcttctctgtccacca
acaacagtcgaaggaagaaatgatgagaaggctcttcttgaacagctggtatccttcctc
agtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaactt
gttcagggaggtggattagatgtattatcagagagatttccaccacaacaagcaacacca
ccattgatgatggaagaaagacccaatctttattcccagccttattcttctccttcgcct
actgccaatctctctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgttcaagtaacacctcctcgaggtgctttttcacctggcatgggcatgcagacc
aggcagactttaaacagacctccagctgcacccaaccaacttagacttcaacttcaacag
cgattacaaggacaacagcagttgatccaccaaaatcggcaagctatcttgaaccagttt
gcagcaaacgctcctgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaatgcccaaatgttggcacagcgccagcgggagctgtatagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgcttatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccgcagcaattcccctacccaccaagctatggtacaaatccaggaacccca
cctgcttctaccagcccgttttcacaactggcagcaaatcctgaggcaaccttggccaac
cgcaacagcatggtgaacagaggcatgacaggaaacatgggaggccagtttggcactgga
atcagtcctcagatgcagcagaatgtcttccagtacccaggatcaggaatggttccccaa
ggtgaggccaacttttctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagcagactccgcccacttctggctaccagtcacca
gacatgaaggcctggcagcaaggagcaatgggaaacagcaatgtgttcagtcaagctgtc
cagaaccagcccacgcctgcacagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcagatg
agctctttgcagatgccaggcatgaatactgtgtgccctgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccacggaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaaccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system