KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008817
Entry
103008817         CDS       T03086                                 

Gene name
CDC42
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04062  Chemokine signaling pathway
bacu04144  Endocytosis
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04530  Tight junction
bacu04660  T cell receptor signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04722  Neurotrophin signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu04912  GnRH signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103008817 (CDC42)
   04014 Ras signaling pathway
    103008817 (CDC42)
   04015 Rap1 signaling pathway
    103008817 (CDC42)
   04370 VEGF signaling pathway
    103008817 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103008817 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103008817 (CDC42)
   04520 Adherens junction
    103008817 (CDC42)
   04530 Tight junction
    103008817 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103008817 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103008817 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    103008817 (CDC42)
   04670 Leukocyte transendothelial migration
    103008817 (CDC42)
   04062 Chemokine signaling pathway
    103008817 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103008817 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103008817 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    103008817 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008817 (CDC42)
   05205 Proteoglycans in cancer
    103008817 (CDC42)
   05203 Viral carcinogenesis
    103008817 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103008817 (CDC42)
   05211 Renal cell carcinoma
    103008817 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103008817 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103008817 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103008817 (CDC42)
   05135 Yersinia infection
    103008817 (CDC42)
   05100 Bacterial invasion of epithelial cells
    103008817 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103008817 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103008817 (CDC42)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103008817 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103008817 (CDC42)
   04031 GTP-binding proteins [BR:bacu04031]
    103008817 (CDC42)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    103008817 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    103008817 (CDC42)
  Macropinocytosis
   Ras GTPases
    103008817 (CDC42)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103008817 (CDC42)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   103008817 (CDC42)
  Exosomal proteins of breast milk
   103008817 (CDC42)
GTP-binding proteins [BR:bacu04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    103008817 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 103008817
NCBI-ProteinID: XP_007175142
UniProt: A0A383ZJ74
LinkDB
Position
Un
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggcgatggtgccgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatctgagtatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagagccttatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcctcattcgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccagattgatctcaga
gatgacccctctactattgagaaacttgccaagaataaacagaagccgatcaccccagag
actgcggaaaaactggctcgcgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system