KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008859
Entry
103008859         CDS       T03086                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase 1
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00020  Citrate cycle (TCA cycle)
bacu00620  Pyruvate metabolism
bacu01100  Metabolic pathways
bacu03320  PPAR signaling pathway
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04910  Insulin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04931  Insulin resistance
bacu04964  Proximal tubule bicarbonate reclamation
Module
bacu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103008859 (PCK1)
   00020 Citrate cycle (TCA cycle)
    103008859 (PCK1)
   00620 Pyruvate metabolism
    103008859 (PCK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103008859 (PCK1)
   04151 PI3K-Akt signaling pathway
    103008859 (PCK1)
   04152 AMPK signaling pathway
    103008859 (PCK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103008859 (PCK1)
   04922 Glucagon signaling pathway
    103008859 (PCK1)
   04920 Adipocytokine signaling pathway
    103008859 (PCK1)
   03320 PPAR signaling pathway
    103008859 (PCK1)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    103008859 (PCK1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103008859 (PCK1)
Enzymes [BR:bacu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     103008859 (PCK1)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 103008859
NCBI-ProteinID: XP_007185317
UniProt: A0A452CJB4
LinkDB
Position
Un
AA seq 622 aa
MPPQLSDGLNYSAKVVQGTLDSLPQAVREFVESNAKLCRPDQIHICDGSEDENRQLLGHM
EEEGVIKRLRKYDSCWLALTDPRDVARIESKTVIITQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSRIGIELTDSPYVVTSMRIMTRMGTPV
LEALGDGEFVKCLHSVGCPLPLKKPLVNNWACNPEMTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPKGQKKYFAAAFPSACGKTNLAMMNPTL
PGWKVECVGDDIAWMKFDRQGNLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDQPLASGIKLISWKGKEWDPKDEEPCAHPNSRFCTPASQCPIIDPDW
ESPDGVPIEAIIFGGRRPVGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKVIMHDPF
AMRPFFGYNFGQYLAHWLSMAQRPEAKLPKIFHVNWFRKDKAGRFLWPGFGENSRVLEWM
FTRVGGEGGAKLTPIGYIPDEDALDLRGLGDVNVKELFHISKEFWEEEVEGIQKYLEEQV
NADLPHEIESEVLALKQRISQM
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctcctcagctctcagacggcctcaactactcagccaaagtcgtccagggcaccctg
gacagcctgccccaggccgtgagagagttcgtggagagcaacgccaagctgtgccggccc
gaccagatccacatctgcgacggctccgaggatgagaaccggcagctgctgggccacatg
gaggaggagggcgtgatcaagaggctgcggaagtacgacagctgctggttggctctcact
gaccccagggatgtggccagaattgaaagcaagacggtcatcattactcaagagcaaaga
gatacggtgcccatccccaaaaccggcctcagccaactgggtcgctggatgtccgaggag
gattttgagaaagcgttcaatgcccgatttccagggtgcatgaaaggtcgcaccatgtac
gtcatcccattcagcatggggcccctgggctcgcctctgtccaggatcggcattgagctg
acagactcgccctacgtggtgaccagcatgcgcatcatgacgcggatgggcacgcccgtc
ctggaggcgctgggggacggggagttcgtcaagtgcctccattccgtggggtgccctttg
cctttaaaaaagcctttggttaacaactgggcctgcaacccggagatgacactcatcgcc
cacctgcccgaccgcagagaaatcatctccttcgggagcgggtacggcgggaactcgctc
cttgggaagaagtgctttgctctcaggatggccagccggctggccaaggaggaggggtgg
ctggcagagcacatgctgattctgggcataaccaaccccaagggccagaagaagtacttc
gcggctgcctttcccagcgcctgcgggaagaccaacctggccatgatgaaccccaccctc
ccagggtggaaagtagagtgtgtgggcgatgacatcgcctggatgaaatttgaccgacaa
ggtaacttgcgggccatcaacccagagaacgggttttttggtgtcgctcctggaacctct
gtgaagacaaaccccaatgccatcaagaccatccagaagaataccatcttcaccaatgtg
gccgagaccagcgatgggggcgtttactgggaaggcattgaccagccgctggcctcgggc
atcaagctcatttcctggaagggcaaggagtgggaccccaaggatgaggagccttgcgcc
caccccaactcgcggttctgcacccctgccagccagtgccccatcattgaccctgactgg
gagtctccggacggcgtgcccatcgaggccatcatcttcggagggcgccgacctgttggc
gtccctctggtctatgaggctctcagctggcagcatggcgtgtttgtgggtgcggccatg
agatcggaggccacggcagcggcagaacacaagggcaaagtcatcatgcacgaccccttc
gccatgcggcccttcttcggctacaacttcggccagtacctggcgcactggctcagcatg
gcccagcgccccgaggccaagctgcccaagatcttccacgtcaactggttccgcaaggac
aaggccggcaggttcctctggccgggcttcggcgagaactccagggtgctggagtggatg
ttcacccgcgttggcggggaagggggcgccaagctcacgcccatcggctacatccccgac
gaggacgccctggaccttcggggcctgggggacgtcaacgtgaaggagctcttccacatc
tccaaggagttctgggaggaggaggtagaaggcatccagaagtacctggaggaacaggtg
aacgccgacctcccccacgagatcgagagcgaggtcctggccctgaagcaaagaatcagc
cagatgtaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019398
Entry
103019398         CDS       T03086                                 

Gene name
PCK2
Definition
(RefSeq) phosphoenolpyruvate carboxykinase 2, mitochondrial
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00020  Citrate cycle (TCA cycle)
bacu00620  Pyruvate metabolism
bacu01100  Metabolic pathways
bacu03320  PPAR signaling pathway
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04910  Insulin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04931  Insulin resistance
bacu04964  Proximal tubule bicarbonate reclamation
Module
bacu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103019398 (PCK2)
   00020 Citrate cycle (TCA cycle)
    103019398 (PCK2)
   00620 Pyruvate metabolism
    103019398 (PCK2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103019398 (PCK2)
   04151 PI3K-Akt signaling pathway
    103019398 (PCK2)
   04152 AMPK signaling pathway
    103019398 (PCK2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103019398 (PCK2)
   04922 Glucagon signaling pathway
    103019398 (PCK2)
   04920 Adipocytokine signaling pathway
    103019398 (PCK2)
   03320 PPAR signaling pathway
    103019398 (PCK2)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    103019398 (PCK2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103019398 (PCK2)
Enzymes [BR:bacu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     103019398 (PCK2)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-GeneID: 103019398
NCBI-ProteinID: XP_007180660
UniProt: A0A383ZZX3
LinkDB
Position
Un
AA seq 640 aa
MAAVYRPGLRLRWHGLSPWGWPSRRSIQTLRVLSGDLGQLPARVRDFVENSARLCQPENI
HICDGTEAENTATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTV
PLPAGGARGQLGNWMSPAEFQQAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTD
SAYVVASMRIMTRLGTPVLQALGDGDFVKCLHSVGQPLTGQGEPVSQWPCNPEKTLIGHV
PDEREIVSFGSGYGGNSLLGKKCFALRIASRLARDEGWLAEHMLILGITNPAGKKRYVAA
AFPSACGKTNLAMMRPALPGWRVECVGDDIAWMRFDSDGRLRAINPENGFFGVAPGTSAT
TNPNAMATIQSNTLFTNVAETSDGGVYWEGIDQPLSPGVTVTSWLGKPWKPGDKEPCAHP
NSRFCAPARQCPIIDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRS
EATAAAEHKGKVIMHDPFAMRPFFGYNFGRYLEHWLSMEGLKGARLPRIFHVNWFRRDEA
GHFLWPGFGENARVLDWICRRLEGEDSAQETPIGLVPKEGALDLSGLGAIDTTQLFSLPK
DFWEQEVRDIRSYLTEQVNQDLPKEVVAELEALEGRVRRM
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggccgctgtgtaccgccccggcctgcggcttagatggcatgggctgagcccctggggc
tggccctcacggcgcagtatccagaccctgcgagtactgagtggagacctgggccagctg
cctgctagggttcgagacttcgtggaaaacagtgcccgcctgtgccaaccagagaacatc
cacatctgtgatgggaccgaggcagaaaatactgccacgctaaccctgctggaacagcag
ggactcatccgaaagctcccaaagtacaacaactgctggctggcccgcacagaccccaag
gatgtggcacgagtagagagcaagacggtgattgtaactccttctcaacgggacacggtg
cccctcccggctggcggggcccgtgggcagctgggcaactggatgtccccagctgagttc
cagcaagccgtggatgagaggtttccaggctgcatgcaaggccgaaccatgtatgtgctg
ccattcagcatgggtcccgtgggctccccactgtcccgcatcggagtgcagctcacggac
tccgcctacgtggtggcaagcatgcggattatgacccggctggggacgcctgtgcttcag
gccctgggagatggcgactttgtcaagtgtctgcactccgtgggccagcccctgactggg
caaggggagccggtgagccagtggccatgcaacccagagaaaaccctgattggccacgtg
cccgacgagcgggagatcgtctccttcggcagcggctatggtggcaactccctgctgggc
aagaagtgctttgcccttcgcatcgcctctcggctggcccgggatgagggctggctggcg
gagcacatgctgatcctgggtatcaccaaccctgcggggaagaagcgctatgtggcagct
gccttccccagcgcctgtggcaagacaaacctggccatgatgcggccggcactgccaggc
tggagagtggagtgtgtgggggatgacatcgcctggatgaggtttgacagtgatggtcga
ctccgggccatcaaccctgagaatggcttctttggggtggcccctggcacctctgccacc
accaatcctaatgccatggccacaatccagagtaacacccttttcaccaacgtggctgag
accagcgatggcggcgtatactgggagggcattgaccagcctctttcacctggcgtcacc
gtgacctcctggctgggcaaaccctggaaacctggtgacaaggagccctgtgcacatccc
aattctcgcttttgtgccccggctcgccagtgccccatcatagaccccgcctgggaggcc
cctgagggtgtccccattgacgccatcatctttggaggccgcagacccaaaggagtcccc
ctggtatatgaggccttcaactggcgccacggggtgtttgtgggcagcgccatgcgctcg
gaggccactgccgcggctgaacacaaagggaaggtcatcatgcacgacccatttgccatg
cggcccttttttggctacaactttgggcgctaccttgaacactggctgagcatggagggc
ctcaaaggggcccggctgccccgcatcttccatgtcaactggttccggcgcgatgaggca
ggccacttcctgtggccaggatttggagagaatgctcgggtgctagactggatctgccgg
cggctagagggggaggacagtgcccaagaaacgcccattgggctggtgccaaaggaaggt
gccttggatctcagcggcctgggagccatagacaccacccagctgttctcgctccccaag
gacttctgggaacaggaggttcgtgacattcggagctacctgacagagcaggtcaaccag
gatctgcccaaggaggtggtggctgagctggaggccctggagggacgtgtgcgcagaatg
tga

DBGET integrated database retrieval system