KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009421Help
Entry
103009421         CDS       T03086                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00030  Pentose phosphate pathway
bacu00051  Fructose and mannose metabolism
bacu00052  Galactose metabolism
bacu01100  Metabolic pathways
bacu01200  Carbon metabolism
bacu01230  Biosynthesis of amino acids
bacu03018  RNA degradation
bacu04152  AMPK signaling pathway
bacu05230  Central carbon metabolism in cancer
Module
bacu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103009421 (PFKM)
   00030 Pentose phosphate pathway
    103009421 (PFKM)
   00051 Fructose and mannose metabolism
    103009421 (PFKM)
   00052 Galactose metabolism
    103009421 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103009421 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103009421 (PFKM)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    103009421 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bacu01009]
    103009421 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bacu03019]
    103009421 (PFKM)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103009421 (PFKM)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103009421 (PFKM)
Messenger RNA biogenesis [BR:bacu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103009421 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 103009421
NCBI-ProteinID: XP_007179316
LinkDB All DBs
Position
Un
AA seq 780 aa AA seqDB search
MTHEDHHEAKTLGVGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVFFVHEGYQGLVD
GGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKSGKITVEEAAKSRYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDNDWE
EHLCRRLSETRNRGSRLNIIIVAEGAIDRNGKPISSEDIRNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTR
AMDERRFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSASYTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVLIGGFEAYTGGLELMEGRKHYDELCIPFVVIPATVSNNVPGSDFSV
GTDTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHFEHVSRKRSGEANV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagaccaccatgaagccaaaaccctgggggttggcaaagccatcgccgtg
ttaacctccggtggcgatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggcatctatactggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggagataacatcagggaagccacctgggagagtgtttcgatgatgcttcagctggga
ggcacggtgattggaagcgcccggtgcaaggactttcgggaacgagagggccggctccga
gctgcccacaacctggtgaagcgcgggatcaccaacctgtgcgtcattgggggtgacggc
agcctcaccggggccgacaccttccgctctgagtggagtgacttgttgagcgacctccag
aaatcaggtaagatcacagtggaggaggctgccaagtccaggtacctgaacattgtgggt
ctggttggatcaattgacaacgacttttgcggcactgacatgaccatcggcactgactct
gccctgcaccggatcatagagattgtagatgccatcaccactaccgctcagagccaccag
aggacatttgtgttagaagtgatgggccggcactgtggatacctggcccttgtcacctct
ctctcctgtggggccgactgggtttttattcctgagtgtccgccagataatgactgggag
gagcacctctgccgccggctcagcgagacaaggaaccgtggttctcgtctcaacatcatc
attgtggctgagggtgcgattgacaggaatgggaaaccgatcagctcagaagacatcaga
aatctggtggtcaagcgtctgggatatgacacccgggtcaccgtcttggggcatgtgcag
cggggtgggacaccgtcggcctttgacagaatcctgggcagcaggatgggtgtggaggca
gtgatggctcttttggaggggaccccggacaccccagcctgtgtggtgagcctctctggt
aaccaggctgtgcgcctgcccctcatggagtgtgtccaggtgaccaaagacgtgaccagg
gccatggatgagaggagatttgatgaagccttgaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctggctcatgtcagacccccagtatctaagagtgcctct
tacacagtggccgtgatgaatgtaggggccccggccgcaggcatgaatgccgccgtccgc
tccaccgtgagaatcggtctcatccagggcaaccgagtgctggttgtacacgacggcttc
gagggcctggccaagggtcagatcgaggaggctggctggagctatgttgggggctggact
ggccaaggtggttctaaacttggaactaaaagaactctacccaagaagagcttcgaacag
atcagtgccaacatcaccaagttcaacattcagggccttgtcctcatcgggggctttgag
gcttacacggggggcctagagctgatggagggcaggaagcactatgacgagctctgcatc
ccgtttgtggtcatccctgccacggtctccaacaacgtgcccggctcggacttcagcgtg
gggaccgacacggctctcaacaccatctgcatgacctgtgaccgcatcaagcagtcagcg
gcaggcaccaagcgccgggtgtttatcattgaaactatgggtggctattgcgggtacctg
gccaccatggcgggcctggcagccggggccgatgctgcctatatttttgaggagcccttc
accattcgagacctgcaggtgaacgtggaacatctggtacaaaagatgaaaacaactgtg
aagaggggactggtgttaaggaatgagaagtgcaatgagaactataccactgacttcatc
ttcaacttgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggt
cacatgcagcagggtgggagcccaactccatttgacaggaattttgccactaagatgggt
gcaaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatc
tttgccaataccccagactcgggctgtgttctggggatgcgtaagagggccctggtcttt
caacccgtgactgagctgaaggaacagacagattttgagcaccgcatccccaaggaacag
tggtggctgaagctgaggcccatcctcaaaatcctagccaagtatgagattgacttggat
acctcagatcacgcccactttgagcacgtcagtcggaagcggtccggggaagctaacgtc
taa

DBGET integrated database retrieval system