KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009571Help
Entry
103009571         CDS       T03086                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00053  Ascorbate and aldarate metabolism
bacu00071  Fatty acid degradation
bacu00280  Valine, leucine and isoleucine degradation
bacu00310  Lysine degradation
bacu00330  Arginine and proline metabolism
bacu00340  Histidine metabolism
bacu00380  Tryptophan metabolism
bacu00410  beta-Alanine metabolism
bacu00561  Glycerolipid metabolism
bacu00620  Pyruvate metabolism
bacu01100  Metabolic pathways
Module
bacu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103009571 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    103009571 (ALDH2)
   00620 Pyruvate metabolism
    103009571 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103009571 (ALDH2)
   00561 Glycerolipid metabolism
    103009571 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103009571 (ALDH2)
   00310 Lysine degradation
    103009571 (ALDH2)
   00330 Arginine and proline metabolism
    103009571 (ALDH2)
   00340 Histidine metabolism
    103009571 (ALDH2)
   00380 Tryptophan metabolism
    103009571 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103009571 (ALDH2)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103009571 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 103009571
NCBI-ProteinID: XP_007170973
UniProt: A0A383Z733
LinkDB All DBs
Position
Un
AA seq 422 aa AA seqDB search
MDASRRGWLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLRCLRYYAGWADK
YHGKTIPIDGDYFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTP
LTALYVANLIKEAGFPPGVVNIIPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQTAAG
NSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAKF
VERSVARARSRVVGNPFDSQTEQGPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRG
YFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVRRANNSKYGLAAAVFTKDLDK
ANYLSQALQAGTVWVNCYDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVKVPQK
NS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgtccagaaggggctggcttctgaaccgcctggctgatctgattgagcgggac
cggacctacctggcagccttggagaccctggacaacggcaagccctacgtcatttcctac
ctggtggatttggacatggttctcagatgtctccgttactatgccggctgggctgataag
taccatgggaaaaccattcccatcgatggggactacttcagctacacccgccatgaacct
gtgggagtgtgcgggcagatcatcccgtggaacttcccgctcttgatgcaagcatggaaa
ctgggaccagccttggcgactggaaacgtggttgtgatgaaggtggctgagcagactcca
ctcactgccctctatgtggccaacttgattaaggaggccggctttcctcctggcgtggtc
aatatcatacctggatttggccccacggctggggccgccatcgcctcccatgaggatgtg
gacaaagtggccttcacaggctccacagaggttggccacctaatccagactgctgcgggg
aacagtaacctcaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatg
tcagatgctgacatggactgggctgtggagcaggcccacttcgccctgttcttcaaccag
ggccagtgctgctgtgcaggctcccggacctttgtgcaggaggacatttatgccaagttt
gtggagcggagtgttgcccgggccaggtctcgtgtggtcgggaacccctttgacagccag
actgagcaggggccgcaggtggatgaaactcagtttaagaaggtccttggctacatcaaa
tctgggaaggaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggc
tacttcatccagcccaccgtgtttggagacgtgcaggatggcatgaccatcgcaaaggag
gagatctttgggccagtgatgcagattctgaagttcaagaccatagaggaagtcgttagg
agagccaacaattccaagtacgggctggccgcagctgtcttcacaaaggacttggacaag
gccaattatctgtcccaagccctccaggctggcaccgtgtgggtcaactgctatgatgtg
tttggggcccagtcaccgtttggtggctacaagctgtctgggagcggccgggagctggga
gagtatgggcttcaggcatacactgaagtgaaaactgtcacagtcaaagttcctcagaag
aactcataa

DBGET integrated database retrieval system