KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009601
Entry
103009601         CDS       T03086                                 

Gene name
ESR1
Definition
(RefSeq) estrogen receptor 1
  KO
K08550  estrogen receptor alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103009601 (ESR1)
   04917 Prolactin signaling pathway
    103009601 (ESR1)
   04919 Thyroid hormone signaling pathway
    103009601 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103009601 (ESR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103009601 (ESR1)
   05205 Proteoglycans in cancer
    103009601 (ESR1)
  09162 Cancer: specific types
   05224 Breast cancer
    103009601 (ESR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103009601 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103009601 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103009601 (ESR1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103009601 (ESR1)
Nuclear receptors [BR:bacu03310]
 3. Estrogen like
  3A. Estrogen receptor
   103009601 (ESR1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Oest_recep ESR1_C
Other DBs
NCBI-GeneID: 103009601
NCBI-ProteinID: XP_007196989
LinkDB
Position
Un
AA seq 588 aa
MTMTLHTKASGMALLHQIQANELEPLNRPQLKIPLERPLSEVYVDSSKPAVYNYPEGAAY
DFNAAAAASAPVYGQSGLAYGPGSEAAAFSANGLGGFPPLNSVISGWKYARYDDGGDSDG
EGDSLGKRFLAPLSSPSPSHLGGLPNSDNRRQGGRERLASTSDKGSMAMESAKETRYCAV
CNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYE
VGMMKGGIRKDRRGGRMLKHKRQRDDGEGRNEAEPSGDRRSANLWPSPLLIKHTKKNSPV
LSLTADQMISALLEAEPPIIYSEYDPTRPFSEASMMGLLTSLADRELVHMINWAKRVPGF
VDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDM
LLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLI
HLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAH
RLHAPANFGSAPTEDVNQSQLATAGSTSSHSLQTYYITGEAENFPTTV
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgaccatgaccctgcacaccaaagcgtctggcatggccctgctgcaccagatccaagcc
aacgagctggagcccctgaaccgcccgcagctcaagatccccctggagcggcccctgagc
gaggtgtacgtggacagcagcaagcccgccgtgtacaactaccccgagggcgccgcgtac
gacttcaacgccgcggccgccgcctccgcgcccgtctacggccagtcgggcctcgcctac
ggccccgggtccgaggcggccgcgttcagcgccaacggcctgggggggttcccgccgctc
aacagcgtaatttcggggtggaaatatgcacgctatgatgatggtggtgatagtgatggt
gaaggtgattcccttgggaagcgattcctagcaccgctttcctcgccctccccgtcccac
cttggagggctgccaaattcagataatcggcgccagggtggcagagagagattggccagc
accagtgacaagggaagcatggccatggaatctgccaaggagactcgctactgtgcagtg
tgcaatgactatgcctcaggctaccattatggagtttggtcttgcgagggctgtaaggcc
ttcttcaagagaagtattcaaggacataatgactacatgtgtccggctaccaaccagtgc
acgattgataaaaacaggaggaagagctgtcaggcctgccggctacgcaagtgctacgaa
gtgggcatgatgaaaggggggatacggaaagaccgcagaggagggagaatgttgaagcac
aagcgccagagagatgatggggagggcaggaacgaagcggagccctctggagacaggaga
tctgccaacctttggccaagcccactcttgattaaacacactaagaagaacagccccgtc
ttgtccctgacagccgatcagatgatcagtgccttgttggaggctgagccccccataatc
tattccgagtacgatcctaccagacccttcagtgaggcttcaatgatgggcttgctgacc
agccttgcagacagggagctggtccacatgatcaactgggcaaagagagtgccaggattt
gtggatttgaccctccatgatcaggtccaccttctggaatgtgcctggctagagattctc
atgattggtcttgtctggcgctccatggagcacccagggaagctcctgtttgctcctaac
ttgctcctggacaggaaccagggaaaatgtgttgagggcatggtggagatctttgacatg
ttgctggctacatcgtctcggttccgtatgatgaatctccagggagaggagtttgtgtgc
ctcaaatccatcattttgcttaattctggagtgtacacatttctgtccagcaccctgaag
tctctggaagagaaggaccatatccaccgtgtcctggacaagatcacagacaccttgatc
catctgatggccaaagcgggcctgactctgcagcaacagcaccggcgtctggcccagctc
ctcctcatcctctctcacatcaggcacatgagtaacaaaggcatggagcatctgtacagc
atgaagtgcaagaatgtggtgcctctctatgacctgctgctggagatgctggatgcgcac
cgcctgcacgccccagccaatttcgggagcgcacccacggaggacgtgaaccagagccag
ctggccaccgccggctcaacttcatcacattccttgcaaacgtattacatcaccggggag
gcagagaatttccccaccacagtctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014339
Entry
103014339         CDS       T03086                                 

Gene name
ESR2
Definition
(RefSeq) estrogen receptor 2
  KO
K08551  estrogen receptor beta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04929  GnRH secretion
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103014339 (ESR2)
   04915 Estrogen signaling pathway
    103014339 (ESR2)
   04917 Prolactin signaling pathway
    103014339 (ESR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014339 (ESR2)
  09162 Cancer: specific types
   05224 Breast cancer
    103014339 (ESR2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103014339 (ESR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103014339 (ESR2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103014339 (ESR2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103014339 (ESR2)
Nuclear receptors [BR:bacu03310]
 3. Estrogen like
  3A. Estrogen receptor
   103014339 (ESR2)
SSDB
Motif
Pfam: ERbeta_N Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 103014339
NCBI-ProteinID: XP_007193045
UniProt: A0A384B075
LinkDB
Position
Un
AA seq 552 aa
MDIKNSPSSLNSPVSYNCSQSILPLEPGPIYIPSSYVESHHEYSAMTFYSPAVMNYSIPN
NSEGGPGRQTTSPNVLWPTPGHLSPLAIHCQSSLLYAEPQKSPWCETRSLEHTLPGNRET
LKRKASGSSCASPVTSPSSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDY
ICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRVVRRQRNSDEQLHCLS
KAKKNGGHVTRVKELLLSALSPEQLVLTLLEAEPPHVLVSRPSTPFTEASMMMSLTKLAD
KELVHMIGWAKKIPGFVELSLYDQVRLLESCWLEVLMVGLMWRSIDHPGKLIFAPDLVLD
RLLQRENLNLLRMRGKSGYLSLFLTRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYL
CVKAMILLNSSVYPTAAAPQEADSSRKLAHLLNAVTDALVWVIAKSGIPSQQQSVRLANL
LMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHTLRGSKSSVTGSECSLVEES
ESKEGSQNPQAQ
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggatatcaaaaactcaccatctagccttaactctcctgtctcctacaactgcagtcaa
tccatcctacccctggagccaggccccatatatataccttcctcctatgtagagagccac
catgaatattcagccatgacattctatagccctgccgtgatgaattacagtattcccaat
aactcggaaggtgggcctggtcgacagaccacaagcccaaatgtattgtggccaactcct
gggcacctctctcctttagccatccattgccagtcgtcacttctgtatgcagaacctcaa
aagagtccttggtgtgaaacgagatcattagaacacaccttacctgggaacagagagaca
ttgaaaaggaaggctagtggaagcagttgtgccagccctgttactagtccaagttcaaag
agggatgcccacttctgtgcggtctgcagcgattatgcatcgggatatcactatggagtc
tggtcgtgtgaaggatgtaaggccttttttaaaagaagcattcaaggacataatgattat
atttgtccagctacaaatcagtgtacaatagataagaaccggcgtaaaagctgccaggcc
tgccgacttcggaagtgctatgaagtcggaatggtgaagtgtggctcccggagagaaagg
tgtgggtaccgcgtagttcgaaggcagagaaattctgatgagcagcttcactgcctgagc
aaagccaagaaaaacggtggacacgtgacccgagtgaaggagctgctgctgagtgccctg
agcccagagcagctggtgctcacgctcctcgaggccgagccgccccacgtgctcgtgagc
cgccccagcacgcccttcaccgaggcctccatgatgatgtccctgaccaagctggctgac
aaggagctggtacacatgatcggctgggccaagaaaattccgggcttcgtggagctcagc
ctgtacgaccaagtgcggctcttggagagctgctggttggaggtgctcatggtggggctg
atgtggcgctccatcgaccaccccggcaagctcatctttgctccagacctcgttctggac
aggcttctgcagcgagaaaacttgaacctactgaggatgagaggaaaatccgggtatctc
agcttatttctaacaagggacgaagggaaatgtgtagaaggaattctggaaatctttgac
atgctcctggcaacgacttcaaggtttcgcgagttaaaactccaacacaaagagtatctc
tgtgtcaaggccatgatcctcctcaactccagtgtgtaccctacagctgcagcaccccag
gaggccgacagcagcaggaaactggctcatctactgaacgctgtgacggatgctctggtc
tgggtaatcgccaagagcggcatcccctcccagcagcagtccgtccgcctggctaacctg
ctgatgctcctttctcacgtcaggcacgccagtaacaagggcatggaacacctgctcaac
atgaagtgcaaaaatgtggtccccgtctacgacctgctgctggagatgctgaatgcccac
acacttcgcggcagcaagtcctcggtcacagggtccgagtgcagcctggtggaggagagt
gagagcaaagagggctcccagaacccccaggctcagtga

DBGET integrated database retrieval system