KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009875
Entry
103009875         CDS       T03086                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03460  Fanconi anemia pathway
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    103009875 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103009875 (POLK)
   05202 Transcriptional misregulation in cancer
    103009875 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103009875 (POLK)
   05212 Pancreatic cancer
    103009875 (POLK)
   05225 Hepatocellular carcinoma
    103009875 (POLK)
   05226 Gastric cancer
    103009875 (POLK)
   05214 Glioma
    103009875 (POLK)
   05216 Thyroid cancer
    103009875 (POLK)
   05220 Chronic myeloid leukemia
    103009875 (POLK)
   05217 Basal cell carcinoma
    103009875 (POLK)
   05218 Melanoma
    103009875 (POLK)
   05213 Endometrial cancer
    103009875 (POLK)
   05224 Breast cancer
    103009875 (POLK)
   05222 Small cell lung cancer
    103009875 (POLK)
   05223 Non-small cell lung cancer
    103009875 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103009875 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103009875 (POLK)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     103009875 (POLK)
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    103009875 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH DUF561
Other DBs
NCBI-GeneID: 103009875
NCBI-ProteinID: XP_007175965
UniProt: A0A383ZLE4
LinkDB
Position
Un
AA seq 866 aa
MDSTEEKNDSTKEKNDNYKDDLLLRVGLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNE
LKKEKQVNQRIENMMQQKAQITSQQLRKAQLQVDRFAMELEHSRDLNNTIVHIDMDAFYA
AVEMRDNPELKDKPIAVGSVSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDK
YRAVSREVKDILADYDPNFMALSLDEAYVNITKHLEERQNWPEDKRKYFIKTGNSLENDK
PGKEVNKLREQARSISPLLFEDSPPDLQSPGNPFQVNFEELNNLQILQNSIVFGTSAEEV
VKEIRFRIEQKTTLTASAGIAPNTMLAKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRK
VSGIGKVTEKMLKALGIITCTELYQQRALLSLLFSETSWHYFLHISLGLGSTHLARTFSE
ISKAEEQYSLCQELCSELAQDLQKEGLKGRTVTIKLKNVNFEVKTRASTVSSVVSTAEEI
FAIAKELLRTEIDADFPHPLRLRLMGVRLSGFPNEEEKKHQQRSIIGFLQPGNQALSATR
CILKKTDKDQFLKPLEMAHKKSFFDKKRSERNWSYQDTFKCETVDKQSLQTSQSFQVLKK
RMSENLETLENSDNCHIFTCPVCFREQGSISLEAFNKHVDACLDGPSISGNSKMSSRSHA
SSTEVNEKENVHDSVSLCEKQDYETHQKNTEITSVDSVELAETTGNPSNTEGVDVLSNKH
SEEECSSLPSKSFNMEHCPQNCCAVSLENEDVASLRRKEPLQPYLYEVISDQVLVCPVCN
LEQKTSDLTLFNVHVDICLNKGIIQELRKDKVNPVNQPKESTSTDNSGKVQKIGTKANRP
GLMTKYSASKKTKLNSPRHTLDIFFK
NT seq 2601 nt   +upstreamnt  +downstreamnt
atggatagcacagaggagaagaatgacagcacaaaggagaagaatgacaattacaaagac
gatcttctcctaagggtgggacttaatgataataaagccggaatggaaggattagataaa
gagaaaattaacaaaattataatggaagccacaaaggggtccagattttatggaaacgag
ctcaagaaagaaaagcaagtcaaccaacgaattgaaaatatgatgcaacaaaaagctcaa
attaccagccagcagctaaggaaagcacaattacaggtcgacagatttgcaatggaattg
gaacacagccgggatctgaacaataccatagtacacattgacatggatgctttctatgca
gctgtagaaatgagagacaatccagaactgaaggataaacccattgctgtaggatcagtg
agtatgttgtctacttcaaattaccacgcaaggagatttggtgttcgtgcagccatgcca
ggattcattgcaaaaagactctgcccacaacttattatagtgcccccaaactttgacaaa
taccgagctgtgagtagagaggttaaggacatacttgctgattatgatcccaattttatg
gccctgagtcttgatgaagcctacgtgaatataacaaagcatttagaggaaagacaaaat
tggcctgaggacaaaaggaagtatttcatcaaaacagggaactctctagaaaatgataaa
ccaggaaaggaagttaataaactgcgtgagcaggcacgatccatctctcctctacttttt
gaagatagtcctcctgatttgcagtccccaggaaatcctttccaagtgaactttgaagaa
ctgaataatcttcaaatactccaaaactcaattgtttttggaacatcagctgaggaagtg
gtaaaggaaattcgtttcagaatcgagcaaaaaactacactgacagccagtgcaggcatt
gcaccaaatacaatgttagcgaaagtatgcagtgataagaataaaccaaatggacaatac
caaattcttcctaatagacaagctgtgatggacttcatcaaggacttacccattagaaag
gtttctggaataggaaaagttacagagaaaatgttaaaggcccttggaattattacttgt
acagaactctaccaacagagggcattactttctcttcttttctctgaaacatcttggcat
tatttccttcatatttccttgggtctaggttcaacacacctggcaaggacattcagtgag
ataagtaaagcagaagaacagtacagcttgtgccaagaactttgcagtgaacttgctcaa
gatctgcagaaagaaggacttaagggtagaactgttaccattaagctaaagaatgtgaat
tttgaagtaaaaactcgtgcatctacagtttcatctgttgtttctactgcagaagaaata
tttgctattgctaaagaattgctgagaacagaaattgatgctgattttccacatcccttg
agattaagacttatgggggtgcggctatctggttttcccaatgaagaggagaagaaacac
caacaaaggagcattattggcttcttacagcctggaaaccaagccctgtcagccactagg
tgtatactaaagaaaactgacaaagatcagtttctaaaacctctagaaatggctcataag
aagagtttctttgataaaaaacgatctgaaaggaattggagctaccaggacacatttaaa
tgtgaaactgtagataaacaaagtttacagacatcacaatccttccaagttttaaagaag
aggatgagtgagaatttagaaacattggagaattcagataactgtcatatatttacctgt
cctgtttgcttcagggagcaaggaagcatcagtctggaagcctttaataaacatgtagat
gcatgtcttgatggaccttccatcagtggaaactctaaaatgtcctcacgttcacatgct
tcctctacagaagtgaacgagaaagaaaacgtacatgattctgtttctctctgtgagaag
caggattatgaaactcatcagaagaatacagagatcacatcagtagattctgtagagttg
gcagagactactggtaatccatctaatacagaaggtgtagatgttctaagtaataagcac
agcgaagaggaatgttctagtcttccaagcaaatcatttaatatggaacactgtcctcag
aattgttgtgctgtttcactggaaaatgaagatgttgcatcattaagaaggaaagagccc
ctacaaccttatttatatgaagtgatcagtgaccaagtcctcgtttgtcctgtttgtaac
ctagaacaaaagacttcagatcttaccctattcaatgtgcatgtagatatttgcttaaat
aaaggcattatccaggaactgagaaaggataaggttaatccagttaaccaacccaaagaa
agcacaagtactgataactcaggcaaagtacagaagattggaacaaaagcaaacaggcca
ggactgatgacaaagtactcggcatcaaagaaaacaaaactaaacagtcccagacacacc
cttgatatattttttaaatga

DBGET integrated database retrieval system