KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010027
Entry
103010027         CDS       T03086                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04640  Hematopoietic cell lineage
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04672  Intestinal immune network for IgA production
bacu05140  Leishmaniasis
bacu05200  Pathways in cancer
bacu05310  Asthma
bacu05320  Autoimmune thyroid disease
bacu05321  Inflammatory bowel disease
bacu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103010027 (IL4)
   04151 PI3K-Akt signaling pathway
    103010027 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103010027 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103010027 (IL4)
   04660 T cell receptor signaling pathway
    103010027 (IL4)
   04658 Th1 and Th2 cell differentiation
    103010027 (IL4)
   04659 Th17 cell differentiation
    103010027 (IL4)
   04657 IL-17 signaling pathway
    103010027 (IL4)
   04664 Fc epsilon RI signaling pathway
    103010027 (IL4)
   04672 Intestinal immune network for IgA production
    103010027 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010027 (IL4)
  09163 Immune disease
   05310 Asthma
    103010027 (IL4)
   05320 Autoimmune thyroid disease
    103010027 (IL4)
   05321 Inflammatory bowel disease
    103010027 (IL4)
   05330 Allograft rejection
    103010027 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103010027 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103010027 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103010027 (IL4)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Interleukins
   103010027 (IL4)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Haparin
  Cytokines
   103010027 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 103010027
NCBI-ProteinID: XP_007188619
UniProt: A0A384AN61
LinkDB
Position
Un
AA seq 133 aa
MGLTSQLIPMLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVADVFAAP
KNTTEKETFCRAATVLRHIYGYHKCLNKPLNGLHRNLSSMANMTCSVNEAKKSTLKDFLE
RLKTIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atggggctcacctcccaactgatcccaatgctagtctgtttactggcatgtaccagcaac
ttcgtccatggacacaagtgcgatattaccttacaagagatcatcaaaacgctgaacatc
ctcacagcaagaaagaactcatgcatggagctgcctgtagcagacgtctttgccgcccca
aagaacacaactgagaaggaaactttctgcagggccgcgactgtgcttcggcatatctac
ggataccacaagtgcttgaacaaacccctgaatggacttcacaggaacctcagcagcatg
gcaaacatgacttgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa
aggctaaagacgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system