KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010071
Entry
103010071         CDS       T03086                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04115  p53 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04370  VEGF signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05134  Legionellosis
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103010071 (CASP9)
   04151 PI3K-Akt signaling pathway
    103010071 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103010071 (CASP9)
   04215 Apoptosis - multiple species
    103010071 (CASP9)
   04115 p53 signaling pathway
    103010071 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103010071 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010071 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103010071 (CASP9)
   05212 Pancreatic cancer
    103010071 (CASP9)
   05215 Prostate cancer
    103010071 (CASP9)
   05213 Endometrial cancer
    103010071 (CASP9)
   05222 Small cell lung cancer
    103010071 (CASP9)
   05223 Non-small cell lung cancer
    103010071 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103010071 (CASP9)
   05012 Parkinson disease
    103010071 (CASP9)
   05014 Amyotrophic lateral sclerosis
    103010071 (CASP9)
   05016 Huntington disease
    103010071 (CASP9)
   05020 Prion disease
    103010071 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    103010071 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103010071 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    103010071 (CASP9)
   05152 Tuberculosis
    103010071 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103010071 (CASP9)
   05161 Hepatitis B
    103010071 (CASP9)
   05160 Hepatitis C
    103010071 (CASP9)
   05164 Influenza A
    103010071 (CASP9)
   05162 Measles
    103010071 (CASP9)
   05168 Herpes simplex virus 1 infection
    103010071 (CASP9)
   05163 Human cytomegalovirus infection
    103010071 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103010071 (CASP9)
   05169 Epstein-Barr virus infection
    103010071 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103010071 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103010071 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103010071 (CASP9)
   01002 Peptidases and inhibitors [BR:bacu01002]
    103010071 (CASP9)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     103010071 (CASP9)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103010071 (CASP9)
Peptidases and inhibitors [BR:bacu01002]
 Cysteine peptidases
  Family C14: caspase family
   103010071 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 103010071
NCBI-ProteinID: XP_007175220
UniProt: A0A383ZJ95
LinkDB
Position
Un
AA seq 431 aa
VAALWDALLNRELFTPDMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTG
QDTLASLLRTSRQAAKQDPEAIRTLDLKPVVLGPVSLKPEELRVAKQDPSQPSQGKLAPV
VLGPEELWPAKLRPEVLRPEAPRPVDVGSGGFSEIRAQDRAKGNADLAYVLNADPCGHCL
IINNVNFCHESGLNTRTGSNIDCERMQQRFHLLHFMVEVKCNLTAKQMVQALGELARRDH
GALDCCVVVILSHGCQASHLQFPGAVYGVDGYPVSVEKIVNIFNGTGCPSLGGKPKLFFI
QACGGEQKDQGFEVASTSPEDRTPDSDPEPDATPFQEGPVTFDQPDAVSSLPTPSDILVS
YSTFPGFVSWRDTKSGSWYIETLDSIFEQWAHCEDLQTLLLRVANAVSVKGIYKQIPGCF
NFLRKKLFFKT
NT seq 1296 nt   +upstreamnt  +downstreamnt
gtggccgccctctgggacgctctgctgaatcgcgagctcttcacccccgacatgatcgag
gacatccagcgggcaggctctgggtctcggcgagatcaggccaggcagctgatcatagat
ctagagacccgagggagtcaggcccttcctttgttcatctcctgcttagaggacacaggc
caggacacgctggcttcgttactgagaaccagtagacaagcagcaaagcaggatccagaa
gccatcagaaccctggacctcaagcctgtggtgctcggaccagtgagcctcaaaccagag
gagctgagagtggcgaagcaggatccatcgcagccgagccaaggaaaactcgctccagtg
gtgctggggcctgaggagctctggccagccaagctcaggcccgaggttctcagaccagag
gcacccaggccagtggacgttggttctggaggattcagtgaaatccgtgctcaggacaga
gccaagggaaatgccgacttggcatacgtcctgaacgcagacccctgtggacactgcctc
attatcaacaatgtgaacttctgccacgagtcggggctcaacacccgcacgggctccaat
attgactgtgagaggatgcagcaacgcttccacttgctgcatttcatggtggaggtgaag
tgtaacctgactgccaagcaaatggtccaggctctgggggagctggcgcggcgggaccac
ggtgctctggactgctgcgtggtggtcatcctctctcacggctgtcaggccagccacctc
cagttcccgggcgctgtttatggcgtggatggatatcccgtgtctgtcgagaaaattgtg
aacatcttcaacggaaccggctgccccagcttgggagggaagcccaagctcttcttcatc
caggcctgtggcggagagcagaaagaccaggggtttgaggtggcctccacttcccctgaa
gacaggacccctgacagcgaccctgagccagatgctaccccgttccaggaaggcccagtc
accttcgaccagccggatgccgtgtctagtttgcccacacctagcgacatcttggtgtcc
tactccaccttcccaggttttgtctcctggagggataccaagagtggctcctggtacatc
gagaccctggacagcatttttgagcagtgggctcactgcgaggaccttcagaccctcttg
ctcagggttgctaatgctgtttcagtgaaaggaatttacaaacagattcctggctgtttt
aatttcctccggaaaaaacttttctttaaaacgtaa

DBGET integrated database retrieval system