KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010166
Entry
103010166         CDS       T03086                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05132  Salmonella infection
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103010166 (TCF7L1)
   04390 Hippo signaling pathway
    103010166 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103010166 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103010166 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010166 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103010166 (TCF7L1)
   05225 Hepatocellular carcinoma
    103010166 (TCF7L1)
   05226 Gastric cancer
    103010166 (TCF7L1)
   05216 Thyroid cancer
    103010166 (TCF7L1)
   05221 Acute myeloid leukemia
    103010166 (TCF7L1)
   05217 Basal cell carcinoma
    103010166 (TCF7L1)
   05215 Prostate cancer
    103010166 (TCF7L1)
   05213 Endometrial cancer
    103010166 (TCF7L1)
   05224 Breast cancer
    103010166 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103010166 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103010166 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103010166 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103010166 (TCF7L1)
   05165 Human papillomavirus infection
    103010166 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103010166 (TCF7L1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103010166 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 103010166
NCBI-ProteinID: XP_007175428
UniProt: A0A383ZJU8
LinkDB
Position
Un
AA seq 439 aa
MKWPLLDVPTSATVKDTRSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNDHFSPGSPPTH
LSPEIDPKTAGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSLPPGGFRH
PYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVI
AKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSR
EEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEADGALAS
KSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSTALASPAAPAATHSEQAQPLSLTTKP
ETRAQLALHSAAFLSAKAAATSSGQMGSQPPVLSRPLPLGSVPTALLTSPPSFPATLHAH
QALPVLQAQPLSLVTKSAH
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaaatggcccctcctcgatgtccccaccagtgccacggtcaaggataccaggtcaccg
tccccagcacacttgtctaataaagttcctgttgttcagcacccgcaccacatgcatccg
ttgacgcccctcatcacctacagcaacgaccacttctcccctggctcccctcccacacac
ctctccccagagatcgatccaaagacagcaggaatcccccggccccctcacccatctgag
ctgtctccgtattacccactgtctcccggagctgtcgggcaaatcccccatcccctcggc
tggctcgtcccacagcaaggacagcccatgtactcccttcctcccggcggcttccggcac
ccctaccctgccctcgccatgaatgcctcaatgtccagcctggtttccagtcggttctcc
cctcacatggtggctccggcccatcctggtctgcccacctcagggatcccccaccccgcc
atcgtctcccccatcgtcaagcaggaaccggcaccccccagcctgagcccggccgtgatc
gcgaaatcacccgtcacggtgaaaaaagaggaagaaaagaaaccccatgtgaagaagcct
cttaacgccttcatgttatatatgaaggagatgagggccaaggtggtggccgagtgcacc
ctgaaggaaagtgcagccattaaccagatcctggggagaaagtggcacaacctgtcccga
gaagaacaggccaagtactacgaactggcccggaaggagcggcagcttcactcgcagctc
tacccaacctggtcagcccgggacaactacggtaaaaaaaagaagaggaagcgagaaaag
cagctttcccagacccagtcccagcagcaagtccaggaggcagacggtgctctggcctcc
aaaagcaagaagccatgtgtccagtacctgccccctgagaagccctgtgacagccctgcc
tcctcccacggcagcatgctggactcgccggccaccccctccacggccttggcttccccg
gctgccccggccgccacccactcggagcaagcccagcccctctccctcaccaccaagcca
gagacccgggcccagctggctctccactcggctgccttcctgtcagcgaaggctgccgcc
acctcctctggccagatgggcagccagccccctgtcctgtcccggcccctccccctgggg
tccgtgcccacagctctgctgacgtcccccccttccttcccagccacgctccatgcccac
caggccctccccgtgctccaggcccagcctctttccttggttaccaagtctgcccactaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010923
Entry
103010923         CDS       T03086                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05132  Salmonella infection
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103010923 (TCF7L2)
   04390 Hippo signaling pathway
    103010923 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103010923 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103010923 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010923 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103010923 (TCF7L2)
   05225 Hepatocellular carcinoma
    103010923 (TCF7L2)
   05226 Gastric cancer
    103010923 (TCF7L2)
   05216 Thyroid cancer
    103010923 (TCF7L2)
   05221 Acute myeloid leukemia
    103010923 (TCF7L2)
   05217 Basal cell carcinoma
    103010923 (TCF7L2)
   05215 Prostate cancer
    103010923 (TCF7L2)
   05213 Endometrial cancer
    103010923 (TCF7L2)
   05224 Breast cancer
    103010923 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103010923 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103010923 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103010923 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103010923 (TCF7L2)
   05165 Human papillomavirus infection
    103010923 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103010923 (TCF7L2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103010923 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103010923
NCBI-ProteinID: XP_007173165
UniProt: A0A383ZD97
LinkDB
Position
Un
AA seq 515 aa
MKWPLLDVQAGTLQSRQALKDARSPSPAHIVQCPLPCCTQGHDCQHFYPPSDFTVSTQVF
RDMKRSHSLQKVGEPWCLESNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVD
PKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALT
VNASMSSFLSSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSAKHQDSK
KEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYY
ELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSA
PKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPSSPNLLGSP
PQDAKSQTEQTQPLSLSLKPDPLAHLPMMPPPPALLLAEAAHGKAPALCANGALDLPPAI
PPSSLAQPSTSSLHSHGSLAGTQPQPLSLVTKSLE
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgaaatggccactgcttgatgtccaggcggggaccctccagagcagacaagccctcaag
gatgcccgttctccgtcgccggcacacattgttcagtgccccctcccttgctgcactcag
ggacatgactgtcagcacttctaccccccctcagacttcactgtcagcactcaagtcttc
agggacatgaaaaggagccactccttacaaaaggttggggagccctggtgtttggagtcg
aacaaagtgccggttgtgcaacacccccaccatgtccaccctctcacgcctcttatcaca
tacagcaatgaacacttcacgccgggaaacccacctccacacttaccagctgacgtagac
cccaaaacaggaatcccacggcctccgcaccctccagatatatctccgtattacccacta
tcgcccggcactgtaggacaaatcccccatccgctaggatggttagtaccacagcaaggt
cagccagtgtaccccatcacgacaggaggattccgtcacccctaccccacagctctgact
gtcaacgcttccatgtccagctttctgtcttctaggttccctccccacatggtcccacca
catcatactctacacacgaccggcattccccacccggccatagtcacgccgacagtcaaa
caggaatcttcccagagtgacgtcggctcactccacagcgcaaagcatcaggactccaaa
aaggaagaagaaaagaagaagccccacataaagaaacctcttaacgcattcatgttgtat
atgaaggaaatgagagcgaaggttgtagccgagtgcacattgaaagaaagtgcagccatc
aaccagatcctgggccgaaggtggcacgcactgtccagagaagagcaagcgaaatactac
gagctggcccggaaggagcgacagcttcacatgcagctgtaccccggctggtccgcacgg
gataactatgggaagaagaagaagaggaaaagggacaagcagcccggggagaccaatgaa
cacagcgaatgtttcctaaatccttgcctttcacttcctccgattacagacctgagcgct
cctaagaaatgccgagcgcgctttggccttgatcaacagaataactggtgcggcccttgc
aggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctcagtccaccc
tcttcagatggaagcttactagactcgcctccttcctcccccaacctgctaggctcccct
ccccaagacgccaagtcacagactgagcagacccagcctctctcgctgtccctgaagccc
gaccccctggcccatctgcccatgatgcctccgccgcccgccctcctgcttgccgaggcc
gcccacggcaaggcccccgccctctgtgccaacggggccctggacctgcctcccgccatc
cctccctcatctctggcgcagccgtcgacatcttccttacattcccacggctctctggcc
gggacgcagccgcagccgctctccctcgtcaccaagtctttagaatag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018264
Entry
103018264         CDS       T03086                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 (T-cell specific, HMG-box)
  KO
K02620  transcription factor 7
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05132  Salmonella infection
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103018264 (TCF7)
   04390 Hippo signaling pathway
    103018264 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103018264 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    103018264 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103018264 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018264 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103018264 (TCF7)
   05225 Hepatocellular carcinoma
    103018264 (TCF7)
   05226 Gastric cancer
    103018264 (TCF7)
   05216 Thyroid cancer
    103018264 (TCF7)
   05221 Acute myeloid leukemia
    103018264 (TCF7)
   05217 Basal cell carcinoma
    103018264 (TCF7)
   05215 Prostate cancer
    103018264 (TCF7)
   05213 Endometrial cancer
    103018264 (TCF7)
   05224 Breast cancer
    103018264 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103018264 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103018264 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103018264 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103018264 (TCF7)
   05165 Human papillomavirus infection
    103018264 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103018264 (TCF7)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103018264 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103018264
NCBI-ProteinID: XP_007172202
UniProt: A0A383ZAV8
LinkDB
Position
Un
AA seq 272 aa
MYKDTVYSAFNLLMHYPPPSGAGQHPQPQPSLHNKASQPSHGVPQLSPLYDHFSSPHPTP
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPPLMLGSGVPGHPAAIP
HPAIVPPSGKQELQTYDRSLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECT
LKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREK
HQESNTGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtacaaagacaccgtctactccgccttcaatctgctcatgcactacccacccccgtcg
ggagcagggcagcacccccagccgcagccctcgctgcacaacaaggccagtcagccttcc
cacggcgtcccccaactctctcctctctatgaccatttcagcagcccacaccccacacct
gctccagccgacatcagccagaagcaaggagttcacaggcctctgcagacccctgatctc
tctggcttctactctctgacctcaggcagcatgggacagctcccgcacactgtgagctgg
ttcacccatccacccctgatgctaggttccggtgtacctggtcaccccgcagccatcccc
cacccagccattgtgcccccttcagggaagcaggagctgcagacctatgaccgcagcctg
aagacgcaggcagaatccaaggcagagaaggaagccaagaagccaaccatcaagaagcct
ctcaacgccttcatgctgtacatgaaggagatgagagcaaaggtcattgcagaatgcaca
ctcaaggagagcgctgccatcaaccagatcctgggccggaggtggcacgcactgtcccgg
gaagagcaggccaagtattatgagctggcccgcaaggagaggcagctgcacatgcagctc
tacccaggctggtcggcgcgggacaactacgggaagaagaagaggcggtcacgggaaaag
caccaagaatccaacacaggaggaaaaagaaatgcattcggtacttacccggagaaggcc
gctgccccagccccgttccttccgatgacagtgctctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020844
Entry
103020844         CDS       T03086                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05132  Salmonella infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103020844 (LEF1)
   04390 Hippo signaling pathway
    103020844 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103020844 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103020844 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020844 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103020844 (LEF1)
   05225 Hepatocellular carcinoma
    103020844 (LEF1)
   05226 Gastric cancer
    103020844 (LEF1)
   05216 Thyroid cancer
    103020844 (LEF1)
   05221 Acute myeloid leukemia
    103020844 (LEF1)
   05217 Basal cell carcinoma
    103020844 (LEF1)
   05215 Prostate cancer
    103020844 (LEF1)
   05213 Endometrial cancer
    103020844 (LEF1)
   05224 Breast cancer
    103020844 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103020844 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020844 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103020844 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103020844 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103020844 (LEF1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    103020844 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 103020844
NCBI-ProteinID: XP_007191065
UniProt: A0A384AUK7
LinkDB
Position
Un
AA seq 399 aa
MPQLSGAGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAKISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQDSYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHLPSDVSS
KQGMSRHPPAPEIPTFYPLSPGGVGQITPPLGWQGQPVYPVTGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgccccaactctccggggcaggcggcggcggtgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaagacgagggcgatccccagaaggagaagatttttgccaag
atcagtcaccctgaagaggaaggtgacttagccgacatcaagtcttccttggttaacgag
tccgaaatcatcccggcgagcaacggacacgaggtggccagacaagcacaaacctctcag
gactcctaccacgacaaggccagagaacaccctgatgacggaaagcatccagatggagga
ctctacaacaagggaccctcttactcaagttattccgggtacataatgatgccaaatatg
aataatgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccacgccgtccatcctctcacccccctcatcacttac
agcgacgagcacttttctccaggatcacacccgtcacacctcccatcggatgtcagctcc
aaacaaggcatgtccagacatcctccagctcccgagatccctaccttttatcccctgtct
ccgggtggtgttggacagattaccccacctcttggctggcaaggtcagcctgtatatccc
gtcacgggaggcttcaggcaaccctacccatcctccctgtcagtcgacacttccatgtcc
aggttttctcatcatatgattcccggtcctcctggtccccacacaactggcatcccacat
ccagctatcgtaacgcctcaggtcaaacaggaacacccgcacactgacagcgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccgaaaagacctcacattaag
aagcctctgaatgctttcatgttatacatgaaagaaatgagagcgaatgtcgtagctgag
tgcactctaaaggaaagcgcagctatcaaccagattctaggcagaaggtggcatgccctc
tctcgcgaagagcaggctaaatattatgaattagcacggaaggaaagacagctacatatg
cagctctatccaggctggtctgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaaactacaggaatctacatcaggtacaggtccaagaatgacagctgcctacatctga

DBGET integrated database retrieval system