KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010563
Entry
103010563         CDS       T03086                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04915  Estrogen signaling pathway
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103010563 (TGFA)
   04012 ErbB signaling pathway
    103010563 (TGFA)
   04014 Ras signaling pathway
    103010563 (TGFA)
   04151 PI3K-Akt signaling pathway
    103010563 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103010563 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010563 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103010563 (TGFA)
   05212 Pancreatic cancer
    103010563 (TGFA)
   05225 Hepatocellular carcinoma
    103010563 (TGFA)
   05214 Glioma
    103010563 (TGFA)
   05211 Renal cell carcinoma
    103010563 (TGFA)
   05215 Prostate cancer
    103010563 (TGFA)
   05223 Non-small cell lung cancer
    103010563 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103010563 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 103010563
NCBI-ProteinID: XP_007175626
UniProt: A0A383ZKJ2
LinkDB
Position
Un
AA seq 145 aa
MSCYALDLSRMSFLSPADPPVAAAVVSHFNDCPASHSQFCFHGTCRFLVQEDKPACVCHS
GYVGARCEHADLLAVVAASQKKQAITALVVVSIVALTVLIITCVLIHCCQVRKHCEWCRA
LICRHEKPSALLKGRTACCHSETVV
NT seq 438 nt   +upstreamnt  +downstreamnt
atgtcttgctatgccttggatctgagccgaatgtcttttctctccccagcagacccgccc
gtggccgcagctgtggtgtcccattttaatgactgcccagcttcccacagtcagttctgc
ttccatggaacctgcaggtttttggtgcaagaggacaagccagcatgtgtctgccactct
gggtacgtcggtgcacgctgtgaacacgcggacctcctggccgtggtggccgccagccag
aagaagcaggccattactgccttggtggtggtctccatcgtggccctgactgtcctcatc
atcacgtgtgtgctgatacactgctgccaggtccgaaaacactgtgaatggtgccgggcc
ctcatctgccggcacgagaagcccagtgccctcctgaagggaaggactgcttgctgccac
tcagaaacagtggtctga

DBGET integrated database retrieval system