KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010622Help
Entry
103010622         CDS       T03086                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103010622 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103010622 (SETD1B)
Enzymes [BR:bacu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103010622 (SETD1B)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103010622 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     103010622 (SETD1B)
    COMPASS/SET1 complex (yeast)
     103010622 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 103010622
NCBI-ProteinID: XP_007189723
UniProt: A0A384AQX0
LinkDB All DBs
Position
Un
AA seq 1860 aa AA seqDB search
MDTGAGLEDTWNLILTAGGDLLTLVWKQFWRPQARAAAAAARRIDEFYVGPVPPKQVTFA
KLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQDLHSPS
VMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLK
DGGLSAGCGSGSSSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSS
YSSRQPTPSYLFSQDPTATFKARRHESKFTDAYNRRHEHHYVHNSSAVTAVAGAAATFRG
SVDLPFGAVSSSGPPFKAQPQDSATFAHTPPPTQAASASGVPFKSAFSPYQTPVPPFPPP
PEEPAAATPFGARDGGEFRRVPVPPPLPPTEPLTKEKPGTPPGPPPPDANSMELGGRPTF
GWSPEPCDSPGTPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEG
SPISSSSSQLSPLAPFGANSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDDELDLGL
GPRPPPEPGPPDPTGLLGQTTEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAP
ITSADCPKPMVVTPGTGAVAAPTLLAPTLPLPPPPGFPPLPPPILPPLPPFPPGLFPVMQ
VDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPY
RGPFSLSSTGPGRGQPWPPLPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMK
RDLNRKMVEVVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWG
KGEGLGYEGLGLSIGLRGAIRLPSFKVKRKEPPDTASSGDQKRLRPSASVDEEDEESERE
RDRDMADAPCELAKRDPKGVGVRRRPARPLELDSGGEEDEKESLSASSSSSASSSSGSST
TSPSSSASDKEERESTEEEEEGEEEEEEEEGPRSQISSSSTSSMSDKDDDDEDSEDRDES
ENDDEDAALSETSEKEEADSDGEETVSIATSKAGAESSSESSESSDFESSSESSSSPSED
EEELAAGEEEEDEEEGEEAAADESMAPAAPDEDFEDVATGASATESLVPEEEVDVEAEDE
ASEARTPMLEEPPLPVGVEEPAGCKEPPDEPGLNQEGARLLSPEPPAGEMEARPLPSPEP
TPENNLEVEPEPPALLSLPLQPPLPPPRPPRPPSPPPEPETPDLPLPPVPLEPPHEDQPP
RTPGLCGSLAKSQSAEAVPATPSGEPLPSGGSSGLPLSSPQLPGSPFSYPSPSPGLSSGG
LPRTPGRDFSFTPTFPEPGGPLLLPVCPLPAGRRDDRSGPLASPVLLETGLPLPLPLPLP
LPLALPVPVLRAQTRAPTQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGPLVRPP
GGAPLGRDLLLLPGQPQTPVFPSTHDPRTVTLDFRNAGIPAPPPPPPPPPPPPVEPTKLP
FKELENQWPSEAIPPGPRGRDEVTEEFMDLAKVRGPWRRPPKKRHEDLVASASPELSPPQ
PLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTS
LSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQ
PHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEP
IAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINH
SCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5583 nt NT seq  +upstreamnt  +downstreamnt
atggacacaggtgctgggctggaagacacctggaatctcatcctgactgccggtggtgac
ctcctgaccttggtttggaaacagttttggaggccccaggcgcgcgccgcggcggccgcg
gctcggaggatcgatgagttctatgtgggcccggtgcctccgaagcaggtgacatttgcc
aagctgaatgataacatccgtgaaaacttcctgagggacatgtgcaagaagtatggggag
gtggaggaggtggagattttgtacaatcccaagaccaagaagcacttgggcatcgccaaa
gtggtctttgccacggtcaggggagccaaggaggcggttcaggacttgcacagcccttcg
gtcatgggcaatatcatccacgtggagctggacaccaaaggggaaacccgcatgcggttc
tacgaactgttggtcacgggccgatacacaccccaaaccctcccagtgggcgagctggac
gctgtctctccaatcgtgaatgagaccctgcagctgtcagatgccctgaagcgcctcaaa
gatggtggcctgtctgcaggctgtggctctggctcatcctctgtcacccccaacagtggt
gggacacccttctcccaggacactgcttattccagctgccgcttggacacgcccaactcc
tacggacagggcacaccgctcacgccgcgcctgggcacccccttctcgcaggactccagc
tactccagccgccagcccacgccctcctacctcttcagccaggaccccacagcgaccttc
aaggctcggcgccacgagagcaagttcacggacgcctacaaccgccgccacgagcatcat
tatgtccacaactcttctgcagtcactgcagtggcaggggccgcagccaccttcaggggc
tccgtggacctcccatttggggcagtcagcagcagtggccctccattcaaggcccagcca
caggattcagccacgtttgcccacactccaccgcctacccaagcagcctccgcttctgga
gtcccattcaagtcggctttctctccgtatcagactcctgtgccccctttccccccgccc
cccgaggagcccgctgccgcaaccccctttggggcccgtgacggtggggagttccggaga
gtacctgtgcccccgcccctgccgcccactgagcccctgacgaaggagaagccaggcacg
ccgcctggacccccgccccctgatgccaacagcatggagctgggcggccggccgaccttc
ggctggagtcccgagccctgtgacagtcctggtacgcccacgctggagtcgtcgcctgca
gggccggagaagccccacgacagcctggactcacggatcgagatgctgctgaaggagcag
cgcaccaagctgcccttccttcgggagcaggactcagacaccgagctgcagatggagggc
agcccgatctcctcctcctcctcccagctctccccactggccccctttggcgctaactct
cagcctggctttcgaggccccacaccaccctcctcacgcccatccagcaccggcttggag
gacatcagccccacaccactgcccgactcggatgaggatgatgagcttgacctgggcctg
gggccccggcccccacccgagccaggccccccagaccctaccggtcttctgggtcagaca
actgaggtggccttggacctggctggagacaggaccccaacctcagagaagatggatgag
gggcagcagtcctcgggggaggacatggagatctcagatgacgagatgccctcggccccc
atcaccagcgctgactgccccaagcccatggtggtgacccccgggacgggggctgtggca
gctcccaccctgctggccccgaccttgccattgcccccgccccctggcttcccaccacta
cccccgcccattctgccgccgctgccgcccttcccgccggggctgtttcccgtgatgcag
gtggacatgagccatgtgctgggcggccagtggggcggcatgcccatgtccttccagatg
cagacgcaaatgctgagccgcctgatgacgggccagggcgcttgcccctacccgcccttc
atggccgccgcggccgcagccgcctccgctgggctgcagttcgtcaacctgccgccctac
cggggccccttctccctgagcagcactggccccggccgcgggcagccctggccacccctg
cccaagtttgacccgtcagtgccgccaccaggctacgtgccacgccaggaggacccgcac
aaggccacggtggacggcgtcctgctggtcgtgctcaaggagctcaaggccatcatgaag
cgggacctgaaccgcaagatggtggaggtggtggccttccgggccttcgacgagtggtgg
gacaagaaggagaggatggccaaggcctcgctgaccccggtgaagtctggtgagcacaag
gacgaggacaggccgaagcccaaggaccgcatcgcctcctgcctgctggagtcgtggggc
aagggcgagggcctgggctacgagggcctgggcctgagcattgggctgcgcggggccatc
cgcctgccctccttcaaggtcaagaggaaagagccgccggacactgcctcgtccggcgac
cagaagcggttgcgaccctcagcctccgtggatgaggaggatgaagagtctgagcgggag
cgggaccgcgacatggcggatgccccctgtgagctcgccaagcgggaccccaagggcgtg
ggtgtgcggcggcggccggcccggcccctggagctggacagtggcggggaggaggacgag
aaggagtcgctgtcagcgtcctcgtcctcgtcggcgtcctcatcctcggggtcctcgaca
acctcaccctcctcctcagcctccgacaaggaggagcgagaaagcacggaggaggaagag
gagggggaggaagaggaggaggaggaggaaggccccaggagccagatctcctcctcctcg
acctcatccatgtcagataaggatgacgacgatgaagacagcgaagacagggatgagtct
gagaatgacgacgaggacgcagccctgtcggagacgagtgagaaggaagaagcggactca
gatggagaggagacagtgagcatcgccacctccaaggctggagctgagtcctccagtgag
agttctgagtcttctgacttcgaatcaagctccgagtcctcctcatcaccctcagaagat
gaagaagagctggcagcgggggaggaggaggaagatgaggaggaaggggaggaggcagct
gccgatgaaagcatggctcccgctgctcctgacgaggactttgaggacgtggccacagga
gcatccgcgacggagtcactggtcccagaagaggaggtggacgtcgaggctgaggacgaa
gcctccgaggctcggaccccgatgctggaagagccccccttgcctgtgggtgtcgaggag
ccggctggctgcaaggagccccccgacgagccaggcctgaaccaggaaggggccaggttg
ctgtctccagagccccctgctggagagatggaggcccggcccctgccatccccggagccc
accccagagaacaacctggaagtggagcctgagcccccggcgctgctctccttacccctg
cagccaccgttgccgccccctcgaccaccccggccacccagcccaccaccagagcccgag
accccagacctcccactcccaccagtccctctggagcctccccatgaggaccagcccccg
cgtactccaggcctctgtggcagcttggccaagtcgcagagcgcagaggcagtgccggcc
acaccgagcggggagcccctgccgtcggggggcagcagcggcctgcccctgagctccccg
cagctgccaggcagccccttctcctacccatccccatcccccggcttgagcagcgggggc
ctcccgaggacacctggccgggacttcagcttcacacccaccttccccgagcctggtggg
cccctactgctgcctgtctgtcccctcccagctggccggcgtgatgaccggtctggcccc
ctggcctcccctgtgctcctggagacaggcctgccgctccctctgcccttgcccttgccc
ctgcccttggcattgcccgtacccgtcctgcgggcccagactcgggcccccacccagctg
ccacccctgctgcctgctccgctggccccctgcccaccacccatcaagaggaagccgggc
cggccccggcgatccccgccggctgtgctctccttggatgggcccttggtccggccgcca
ggaggggcccccctgggcagggacctcctgcttctgccaggccagccacagacccctgtc
ttccccagcacccacgacccccggaccgtgaccctggacttccggaacgcggggatcccg
gctccccccccacctcctccgcccccgcctccaccacctgttgagcccaccaagctgccc
tttaaggagctagagaaccagtggccctccgaggccatccctccgggtccccgtgggcgc
gacgaggtcaccgaggagttcatggacctggccaaggtgcgggggccctggcgccggcca
ccgaagaagcgccacgaggacctagtggcctcagcctcccccgagctctcgccgccgcag
cccctctttcggccccgctcggagtttgaggagatgaccatcctgtatgacatctggaat
ggcggcatcgatgaggaggacatccgcttcctgtgtgtcacctacgagcgtctgctgcag
caggacaacggcatggactggctcaatgacacgctctgggtctaccatccctccaccagc
ctctcttcagctaagaagaagaaacgggacgacggcatccgggagcacgtgacaggctgt
gcccgcagcgagggcttctacaccatcgacaagaaggacaagctcagatacctcaacagc
agccgcgccagcaccgatgagccccccacggacacccagggcatgagcatcccagcgcag
cctcacgcctccacacgggctggctcggagcggcgttccgagcagcgccgcctgttgtcc
tccttcactggcagctgtgacagtgacctgctcaagttcaaccagctcaagttccggaag
aaaaagctcaaattctgcaagagtcacattcacgactggggcctgttcgccatggagccc
atcgcggccgacgagatggtgatcgagtacgtgggccagaacatccgccaggtgattgcg
gacatgcgggagaaacgttacgaggacgagggcatcggtagcagctacatgttccgggtg
gaccacgacaccatcatcgacgccaccaagtgcggcaacttcgcgcgtttcatcaaccac
agctgcaaccccaactgctacgccaaggtcatcaccgtggagtcgcagaagaagatcgtc
atctactcgaagcagcacatcaacgtcaacgaggagatcacctacgactacaagttcccc
atcgaggacgtcaagatcccctgcctctgcggctccgagaactgccgggggaccctcaac
tag

DBGET integrated database retrieval system