KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010950
Entry
103010950         CDS       T03086                                 

Gene name
PAX8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04918  Thyroid hormone synthesis
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    103010950 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010950 (PAX8)
   05202 Transcriptional misregulation in cancer
    103010950 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103010950 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103010950 (PAX8)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    103010950 (PAX8)
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1 HTH_38
Other DBs
NCBI-GeneID: 103010950
NCBI-ProteinID: XP_007197466
UniProt: A0A384BCP4
LinkDB
Position
Un
AA seq 457 aa
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDGCVAAKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGSDSKRKLDDSDQDSCRLSLDSQSSGSGPRKHLRTDAFSQHHLEPLECP
FDRQHYPEAYVSPSHTKGEQGLYPLPLLNSALDDGKATLTPSNTPLGRNLSTHQTYPVVA
DPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPAGASVPPFNAFPHAASVYG
QFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSY
SEAWRFPNSSLLSSPYYYSSTSRPSAPPTTAAAFDHL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcctcacaactccatcagatcgggccacggagggctgaaccagctgggaggggccttt
gtgaatggcagacccctgcccgaagtggtgcgtcagcgcatcgtggacctggcccaccag
ggcgtgaggccctgcgacatctcccgccagctccgagtcagccatggctgtgtcagcaag
atcctcggcaggtactacgagactggcagcatccggcctggagtgatagggggctcgaag
cccaaggtggccacccccaaggtggtggagaagatcggggattacaagcggcagaacccg
accatgtttgcctgggagatccgagaccggctcctggccgagggcgtctgtgacaacgac
actgtgcccagtgtcagctccatcaacagaatcatccggaccaaagtgcagcaacccttc
aaccttcccatggacggctgcgtggccgccaagtccctgagcccaggacacacgctgatc
cccagctcagccgtgacgcccccagagtctccccagtctgattctctgggttcaacctac
tccatcaatgggctcctggggatcgcgcagcctggcagcgacagcaagaggaaactggat
gacagtgaccaggacagctgtcggctgagccttgactcccagagcagtggcagtgggccc
cgcaagcaccttcgcacggacgccttcagccagcaccaccttgagccgcttgagtgcccc
tttgatcggcagcactacccagaggcctatgtctcccccagccacaccaaaggcgagcag
ggcctctacccgctgcccttgctcaatagcgccctggacgacgggaaggccaccctgacc
ccttccaatacacccttggggcgcaacctctcgactcatcagacctaccccgtggtggca
gatcctcattcacccttcgccataaagcaggaaacccccgaggtgtccagttctagctcc
accccttcctctttatctagctccgcctttttggatctgcagcaagtcggctccggggtc
ccagccggtgcctcggtcccgcccttcaatgcctttccccatgctgcctccgtgtacggg
cagttcacgggccaggccctcctctcagggcgagagatggtggggcccacgctgcctgga
tacccaccccacatccccaccagtggacagggcagctatgcctcttctgccatcgcaggc
atggtggcaggaagtgaatactctggcaacgcctatggccacaccccctactcctcctac
agcgaggcctggcgcttccccaactccagcttgctgagttccccgtattattacagttcc
acatcaaggccaagcgcgccacctaccactgccgcggcctttgaccatctgtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013413
Entry
103013413         CDS       T03086                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03320  PPAR signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04380  Osteoclast differentiation
bacu04714  Thermogenesis
bacu05016  Huntington disease
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103013413 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103013413 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103013413 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    103013413 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    103013413 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013413 (PPARG)
   05202 Transcriptional misregulation in cancer
    103013413 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103013413 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    103013413 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103013413 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103013413 (PPARG)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    103013413 (PPARG)
Nuclear receptors [BR:bacu03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   103013413 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 103013413
NCBI-ProteinID: XP_007192653
UniProt: A0A384AZB2
LinkDB
Position
Un
AA seq 475 aa
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISAPHYEDIPFPRADPMV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEPSKEVAIRIFQGCQFRSVEAVQEITEYAKS
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggttgacacagagatgccgttttggcccaccaactttgggatcagctccgtggatctt
tctgtgatggacgaccactcccactcctttgacatcaagcccttcaccaccgttgatttc
tccagcatttccgctccacactatgaagacattccgttcccaagagctgacccaatggtt
gcggattataagtatgacctgaaactccaagagtaccaaagtgcaatcaaagtggagcct
gcatccccaccttactattctgaaaagactcagctgtacaataagcctcacgaagagcct
tccaactccctcatggcaattgaatgccgtgtctgtggggataaagcttcagggttccac
tatggagttcatgcttgtgaaggatgcaagggtttcttccggaggacaatcagattgaag
cttatttatgataggtgtgatcttaactgtcggatccacaaaaaaagcagaaataaatgt
cagtactgtcggtttcagaagtgccttgctgtggggatgtctcataatgccatcaggttt
gggcggatgccacaggccgagaaggagaagctgttggcggagatctccagtgatatcgac
cagctgaacccagagtctgctgatctccgggccctggcaaaacatttgtatgactcgtac
ataaagtccttcccgctgaccaaagcaaaggcgagggcgatcttgacaggaaagacaaca
gacaaatcaccatttgttatctatgacatgaattccttaatgatgggagaagataaaatc
aagttcaagcacatcacccccctgcaggagccgagcaaagaagtggccatccgcatcttt
caggggtgtcagttccgttccgtggaagctgtgcaggagatcacagagtatgccaagagt
attcctgggtttgtaaatcttgacttgaatgaccaagtaactctcctaaaatacggcgtc
catgagatcatttacacgatgctggcctccttgatgaataaagatggggttctcatatcc
gagggccaaggattcatgacgagggagtttttaaagagcctgcgaaagccctttggtgac
tttatggagcccaagttcgagtttgctgtgaagttcaatgcactggaattagatgacagc
gacttggcaatatttatagctgtcattattctcagtggagaccgccccggtttgctgaat
gtgaagcccattgaggacatacaagacaacttgctgcaagccttggagctgcagctcaag
ctgaaccaccccgagtcctctcagctctttgccaagttgctccagaaaatgacagacctc
agacagattgtgacagaacacgtgcagctgttgcaagtaataaagaaaacagagacggac
atgagtcttcacccgcttctacaggaaatatacaaggacttgtattag

DBGET integrated database retrieval system