KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010966
Entry
103010966         CDS       T03086                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu03320  PPAR signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04510  Focal adhesion
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04910  Insulin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04931  Insulin resistance
bacu04960  Aldosterone-regulated sodium reabsorption
bacu05145  Toxoplasmosis
bacu05205  Proteoglycans in cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05223  Non-small cell lung cancer
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103010966 (PDPK1)
   04071 Sphingolipid signaling pathway
    103010966 (PDPK1)
   04151 PI3K-Akt signaling pathway
    103010966 (PDPK1)
   04152 AMPK signaling pathway
    103010966 (PDPK1)
   04150 mTOR signaling pathway
    103010966 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103010966 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    103010966 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103010966 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    103010966 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    103010966 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103010966 (PDPK1)
   03320 PPAR signaling pathway
    103010966 (PDPK1)
   04919 Thyroid hormone signaling pathway
    103010966 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103010966 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103010966 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103010966 (PDPK1)
   05231 Choline metabolism in cancer
    103010966 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    103010966 (PDPK1)
   05213 Endometrial cancer
    103010966 (PDPK1)
   05223 Non-small cell lung cancer
    103010966 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103010966 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103010966 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103010966 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103010966 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103010966 (PDPK1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103010966 (PDPK1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   103010966 (PDPK1)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    103010966 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 103010966
NCBI-ProteinID: XP_007181682
UniProt: A0A384A2U4
LinkDB
Position
Un
AA seq 531 aa
MVRTQTESSTAPGVPSCGSRQGPTMDSTAAESRPSANSLQHATQPPPQPRKKRPEDFKFG
KILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKL
YFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGKGIIHRD
LKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDL
WALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRL
GCEEMEGYSPLKAHPFFESITWENLHHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGC
MQVSSSSSSHSLSAADAGLPQRVGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQASG
NPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELR
PEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRYQSHPDAAVQ
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggtgaggacccagactgagtccagcacggcccctggcgttcccagctgtggtagcagg
cagggccccaccatggacagcactgcggccgaatcccggccaagtgccaactcgctgcaa
cacgccacacagccgccaccacagcctcggaagaaacggccagaagactttaaatttggg
aaaattcttggtgaaggctctttttcaacagttgtcctggcccgagaactggcaacctca
agggaatatgctattaaaattctagagaaacgtcacattatcaaagagaacaaagtcccg
tatgtaaccagagagagagacgtgatgtcgcggctggatcaccccttctttgttaaactt
tacttcacatttcaggatgatgaaaagctctactttggccttagttatgccaaaaatgga
gaactacttaaatacattcggaaaattggttcgttcgatgagacatgcacccgattttac
acagctgagatggtgtctgccctagagtacttgcatggcaagggcatcattcacagggac
ctgaaaccagaaaatattttgttaaatgaagatatgcacatccagatcacagattttgga
acagcaaaagtattatccccagagagtaaacaagccagggccaactcgtttgtaggaaca
gcccagtatgtttctccagagctgctcacagagaaatcggcctgtaaaagttcagacctt
tgggctcttggatgcataatataccagcttgtggcaggactgccaccgttccgagctgga
aatgaatatcttatatttcagaagatcattaagttggaatatgactttcctgaaaaattc
tttcctaaggcaagagatcttgtggaaaaacttctggttttagatgccacaaagcgatta
ggttgtgaagaaatggaagggtacagccctctgaaagctcatccgttctttgagtccatc
acgtgggagaacctgcatcaccagacgcctccgaagctcacagcttacttaccggccatg
tcggaagatgatgaggactgctatggcaattacgacaatctcctgagccagttcggctgc
atgcaggtgtcgtcgtcctcctcctcccactccctgtctgccgcggacgcggggctgccc
cagagggtgggaagcaacatcgagcagtatatccacgacctggacactaattcttttgaa
ctggacttacagttttctgaagatgagaagaggttgttattggagaagcaggccagcgga
aacccttggcaccagtttgtagaaaataatttaatactaaaaatgggtccagtagacaag
cgcaagggtttatttgcacggcgacgacaattactgctcacagaagggccacacttatat
tatgtggatcctgtcaacaaagtcttgaaaggtgaaattccatggtcacaagaactccga
ccagaggccaagaattttaaaaccttctttgtccacacgccgaataggacgtattacctg
atggacccgagtgggaatgctcacaaatggtgcaaaaagatccaggaggtgtggaggcac
agataccagagccacccggatgccgccgtgcagtga

DBGET integrated database retrieval system