KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103011001
Entry
103011001         CDS       T03086                                 

Gene name
SIRT1
Definition
(RefSeq) sirtuin 1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00760  Nicotinate and nicotinamide metabolism
bacu01100  Metabolic pathways
bacu04068  FoxO signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04922  Glucagon signaling pathway
bacu05031  Amphetamine addiction
bacu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    103011001 (SIRT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103011001 (SIRT1)
   04152 AMPK signaling pathway
    103011001 (SIRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103011001 (SIRT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103011001 (SIRT1)
  09149 Aging
   04211 Longevity regulating pathway
    103011001 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    103011001 (SIRT1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103011001 (SIRT1)
  09165 Substance dependence
   05031 Amphetamine addiction
    103011001 (SIRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103011001 (SIRT1)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103011001 (SIRT1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     103011001 (SIRT1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     103011001 (SIRT1)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103011001 (SIRT1)
SSDB
Motif
Pfam: SIR2 DUF592
Other DBs
NCBI-GeneID: 103011001
NCBI-ProteinID: XP_007167874
UniProt: A0A383YYX9
LinkDB
Position
Un
AA seq 557 aa
MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQE
CKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKF
AKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCL
ICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDE
VDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHR
LGGEYAKLCCNPVKLSEITEKPPRTQKELAHLSELPPTPLNISEGSSSPEGTSPADSSVI
VTLLDQETKSNGDDPDVSESKNCVEEKSQEVQTSARSIESINEQLESPDLKNVASNTGEK
NERTSVAETVRKCWPARLAKEQISKRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSS
CGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDDADVNERAGGTGFGADGGDQEAVNEA
TSMKQEATSINYPSNKS
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgattggcacagatcctcgaacgattcttaaagatttactgccagaaacaattcctcca
cctgaattggatgatatgacactgtggcagattgttattaacatcctttcagaaccacca
aaaaggaaaaaaagaaaagatattaatacaattgaagatgctgtgaaattactgcaagag
tgcaaaaaaataatagttctaactggagctggggtttctgtttcttgtggaatacctgac
ttcaggtcaagagatggtatttatgctcgccttgcagtagactttccagaccttccagat
cctcaagcaatgtttgacattgaatatttcagaaaagatccaagaccattcttcaagttt
gcaaaggaaatatatcctggacaattccaaccatctctttgtcacaaattcatagccttg
tcagataaggaaggaaaactacttcgcaactatactcagaacatagatacactggaacag
gttgcaggaatccaaaggataattcagtgtcatggttcctttgcaacagcatcttgcctg
atttgtaaatataaagttgactgtgaagctgtacgaggagatatttttaatcaggtggtt
cctcgatgtcctaggtgcccagctgatgaaccacttgctatcatgaaaccagagattgtc
ttttttggtgaaaatttaccagaacagtttcatagagccatgaagtatgacaaagatgaa
gttgatcttctcattgttattgggtcttccctgaaagtaagaccagtagcactaattccg
agttccataccccatgaagtgcctcagatattaattaatagggaacctttgcctcacctg
cattttgatgtagagcttcttggagactgtgatgtcattattaatgaattgtgtcacagg
ttaggtggtgaatacgccaaactttgctgcaaccctgtaaagctttcagaaattactgaa
aaacctccacgaacacaaaaagaattggctcatttgtcagagttgccacccacacccctc
aatatttcagaaggctcgagttcaccagaaggaacctcaccagcagattcttcagtgatt
gtcactcttttagaccaagaaacaaagagtaatggtgatgatccagatgtgtctgaatca
aaaaactgtgtcgaagaaaaatcacaggaagtacagacttctgctaggagcattgaaagt
attaatgaacagttggagagtccggatttgaagaatgttgcctccaatactggggagaaa
aatgaaagaacttcagttgctgaaacagtgagaaaatgctggccagctagactcgcaaag
gagcagattagtaaacggcttgatggtaatcaatatctgtttttaccaccaaaccgttat
attttccatggtgctgaggtatattcagactctgaagatgatgtcttatcctctagttct
tgtggcagtaacagtgatagtggaacatgccagagtccaagtttagaagaacctatggag
gatgaaagtgagattgaagaattttacaatggtttggaagatgatgctgatgttaatgag
agagctggaggaactggatttggagctgatggaggtgatcaagaggcagttaatgaagct
acatctatgaaacaggaagcaacaagcattaactatccatcgaacaaatcataa

DBGET integrated database retrieval system