KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103011267Help
Entry
103011267         CDS       T03086                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00240  Pyrimidine metabolism
bacu00983  Drug metabolism - other enzymes
bacu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    103011267 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103011267 (TK1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     103011267 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 103011267
NCBI-ProteinID: XP_007185838
LinkDB All DBs
Position
Un
AA seq 237 aa AA seqDB search
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSNFSTHDRNTMEALPACVLRDVAQEALGVAVIGIDEGQFFPDIVEFSETMANAGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGVEKEVEVIGGADK
YHSVCRLCYFKKASVQPAGLDSKENKENYPVLGKPGEAPGARKLFAPHQILQCSPAN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacctgcccaccgtgctgcccggctcccccagcaagacccgggggcag
atccaggtgattctcggacccatgttctcaggaaaaagtactgagctgatgagacgcgtc
cgtcgcttccagattgcccagtacaagtgcctggtgatcaaatatgccaaagacacgcgt
tacagcagcaacttctccacgcatgaccggaacaccatggaggccctgccagcctgcgtg
ctccgggacgtggcccaggaggccctgggtgtggctgttataggcatcgacgaagggcag
tttttccccgacatcgtggagttcagcgagaccatggccaatgccgggaagaccgtcatt
gtggctgcactggatgggaccttccagaggaaggcgttcgggaccatcctgaacctggtg
cccctggccgagagtgtggtgaagctgacggcggtgtgcatggagtgcttccgagaggcc
gcctacaccaagaggctgggcgtggagaaagaggtcgaggtgatcggaggagcagacaag
taccactccgtgtgccgcctctgctacttcaagaaggcttcggttcagcctgccgggctg
gacagcaaagagaacaaagagaactacccggtgctgggaaagcccggggaggccccggga
gccaggaagctatttgctcctcaccagatcctgcagtgcagcccggccaactga

DBGET integrated database retrieval system