KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103011683
Entry
103011683         CDS       T03086                                 

Gene name
MAP2K7
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04141  Protein processing in endoplasmic reticulum
bacu04380  Osteoclast differentiation
bacu04530  Tight junction
bacu04620  Toll-like receptor signaling pathway
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04912  GnRH signaling pathway
bacu04926  Relaxin signaling pathway
bacu05010  Alzheimer disease
bacu05016  Huntington disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05161  Hepatitis B
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103011683 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103011683 (MAP2K7)
   04012 ErbB signaling pathway
    103011683 (MAP2K7)
   04668 TNF signaling pathway
    103011683 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103011683 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103011683 (MAP2K7)
   04660 T cell receptor signaling pathway
    103011683 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    103011683 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103011683 (MAP2K7)
   04926 Relaxin signaling pathway
    103011683 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103011683 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103011683 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103011683 (MAP2K7)
   05016 Huntington disease
    103011683 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    103011683 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103011683 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103011683 (MAP2K7)
   05135 Yersinia infection
    103011683 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103011683 (MAP2K7)
   05161 Hepatitis B
    103011683 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103011683 (MAP2K7)
   05169 Epstein-Barr virus infection
    103011683 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103011683 (MAP2K7)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103011683 (MAP2K7)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: STE group
  STE7 family
   103011683 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103011683
NCBI-ProteinID: XP_007169111
UniProt: A0A383Z213
LinkDB
Position
Un
AA seq 435 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFRYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESP
RASGVLSQHHLPFFR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgcgaggctcggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccaacgagcagccctgcag
ctcccactggccaatgatgggggcagccgctcaccgtcctccgagagctccccgcagcac
cccacgcccccagcccggccccgccacatgctggggctcccgtcaaccttgttcacaccc
cgcagcatggagagcatcgagattgaccagaagctgcaggagatcatgaagcagacgggc
tacctgaccattgggggccagcgctaccaggcggaaatcaacgacctggagaacctgggg
gagatgggcagcggcacctgtggccaggtgtggaagatgcgtttccggaagacggggcac
gtcatcgctgtcaagcaaatgcggcgctcggggaacaaggaagagaacaagcggatcctc
atggacctggacgtggtgctcaagagccacgactgcccctacattgtgcagtgcttcggg
accttcatcaccaacacggacgtcttcattgccatggagctcatgggcacgtgcgccgag
aagctcaagaagcggatgcagggccctatccctgagcggatcctgggcaagatgacggtg
gcgatcgtgaaggcactctactacctgaaggagaagcacggcgtgatccaccgggacgtc
aagccctccaacatcctgctggatgagcggggccagatcaagctctgcgacttcggcatc
agcggccgcctcgttgactccaaagccaaaacgcggagcgcaggttgcgctgcctacatg
gcacctgagcgcatcgaccccccggaccccaccaagcccgactacgacatccgggccgat
gtgtggagcctgggcatctccttggtggagctggcgacgggacagtttcgctacaagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagaacccccgctcctgccc
ggtcacatgggcttttcgggggactttcagtccttcgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcgctacgag
acgctggaggtggacgtggcatcctggttcaaggatgtcatggcgaagaccgagtcgccg
cgggcgagcggggtcctgagccagcaccacctgcccttcttcaggtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012105
Entry
103012105         CDS       T03086                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04620  Toll-like receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04912  GnRH signaling pathway
bacu04926  Relaxin signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103012105 (MAP2K4)
   04012 ErbB signaling pathway
    103012105 (MAP2K4)
   04668 TNF signaling pathway
    103012105 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103012105 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    103012105 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103012105 (MAP2K4)
   04926 Relaxin signaling pathway
    103012105 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    103012105 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103012105 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103012105 (MAP2K4)
   05135 Yersinia infection
    103012105 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103012105 (MAP2K4)
   05161 Hepatitis B
    103012105 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103012105 (MAP2K4)
   05169 Epstein-Barr virus infection
    103012105 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103012105 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103012105 (MAP2K4)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103012105 (MAP2K4)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: STE group
  STE7 family
   103012105 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 103012105
NCBI-ProteinID: XP_007175352
UniProt: A0A383ZJT0
LinkDB
Position
Un
AA seq 338 aa
MDTGEQLQCCAGERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVH
KPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELM
STSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSG
NIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELA
TGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKEL
LKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggacacaggagaacagttgcagtgctgtgcaggagagagactgagaacacacagcatt
gaatcgtcaggaaaactgaagatctcccctgagcagcactgggatttcactgcagaggac
ttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtccac
aaaccgagtgggcagataatggcagtgaaaagaattcggtcaacagtggatgaaaaagag
caaaaacaacttctcatggatttggatgtagtgatgcgaagtagtgattgcccgtacatt
gttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactcatg
tctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttattcca
gaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaa
aacttgaaaatcattcacagagatatcaaaccttccaatattcttctggatagaagtgga
aatattaaactctgcgactttggcatcagtggacagcttgtggactccattgccaagaca
agagatgctgggtgcaggccatacatggcacctgaaagaatagacccaagtgcgtcacga
caaggatatgacgtccgctctgatgtctggagtttggggatcacattgtacgaattggcc
acaggccgatttccttatccaaagtggaatagtgtgtttgatcaactaacacaagttgtg
aaaggagacccaccacagttgagtaattctgaggaaagggaattttccccaagtttcatc
aactttgtcaacttgtgccttaccaaggatgaatccaaaaggccaaagtataaagaactt
ctgaaacatccctttattttgatgtatgaagagcgcgctgtcgaggtcgcatgctatgtt
tgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgactga

DBGET integrated database retrieval system