KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103011866Help
Entry
103011866         CDS       T03086                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00512  Mucin type O-glycan biosynthesis
bacu01100  Metabolic pathways
Module
bacu_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103011866 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bacu01003]
    103011866 (WBSCR17)
Enzymes [BR:bacu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103011866 (WBSCR17)
Glycosyltransferases [BR:bacu01003]
 O-Glycan biosynthesis
  Mucin-type
   103011866 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin
Motif
Other DBs
NCBI-GeneID: 103011866
NCBI-ProteinID: XP_007187065
LinkDB All DBs
Position
Un
AA seq 527 aa AA seqDB search
MVFLPVAGSLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSEKISLD
RSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVD
DNSDEEELKAPLEDYVHKRYPGLVKVVRNRKREGLIRARIEGWKVATGQVTGFFDAHVEF
TAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELWCMYISPPKDWW
DAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVL
PCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDV
SERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNSKAKDVCLDQGPLENHTAIL
YPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSRSRLPQLLDCDKVKGSLYKR
WNFIQNGAVMNKGTGRCLEVESRGLAGIDLILRSCTGQRWTIKNFIK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcctgccagtggcaggaagtttatctaaatcccttgggctcattgaaggttat
ggtgggcggggcaaagggggccttcctgctaccctttccccggctgaagaagagaaagcc
aagggaccccatgagaagtatggctacaattcctacctcagtgaaaaaatttcactggat
cgttccattccggattatcgtcccaccaagtgtaaggagctgaagtactccaaggagctg
ccccagatatccatcatatttatcttcgtgaacgaggccctgtcggtgatcctgcggtca
gttcacagcgcggtcaatcacacaccgacccacctgctgaaggaaatcatcctggtggat
gacaatagtgatgaagaggagctgaaggcccctttggaggattatgtccacaaacgctac
cctgggctggtgaaggtggtgagaaatcgaaaaagagagggcctgatccgagctcgcatc
gagggttggaaggtggccaccggccaggtcaccggcttctttgatgcccacgtggagttc
accgctggctgggccgagccggttctctcgcggatacaggagaaccggaagcgggtgatc
ctcccctccatcgacaacatcaaacaggacaccttcgaggtgcagcgatatgagaactcg
gcccacgggtacagctgggagctgtggtgcatgtacatcagccccccgaaagactggtgg
gacgccggagacccttcccttcccatcagaacaccagccatgattggctgctcgtttgtg
gtcaacaggaagttctttggtgaaattggtcttctggaccctgggatggatgtgtacgga
ggagaaaatatcgaacttggaatcaaggtgtggctgtgcgggggcagcatggaggtcctg
ccttgctcacgggtggcccacatcgagcggaagaagaagccatacaacagcaacatcggc
ttctacaccaagaggaatgctctccgggttgccgaggtctggatggacgattacaagtct
cacgtgtacatagcgtggaatctgccactggagaatccaggaattgacataggcgatgtc
tcagaaagaaaagccttgaggaagagtttaaagtgtaagaatttccagtggtacctggac
cacgtctacccagaaatgagaagatacaataacaccattgcctacggggagcttcgcaac
agcaaggcaaaagacgtctgcttggaccaggggccgctggagaaccacacagcaatactg
tacccgtgccatggctggggaccccagctggcccgctacaccaaggagggcttcctgcac
ctgggagccctgggaaccaccacgctcctccctgacacccgctgcctggtggacaactcc
aggagtcgtctgccccagcttctggactgcgacaaggtcaagggcagcctgtacaagcgc
tggaacttcatccagaatggcgccgtcatgaacaagggcacggggcgctgcctggaggtg
gagagccgaggcctggctggcatcgacctcatcctccgcagctgcacggggcagaggtgg
acgattaagaacttcatcaagtag

DBGET integrated database retrieval system