KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012352
Entry
103012352         CDS       T03086                                 

Gene name
TICAM1
Definition
(RefSeq) toll like receptor adaptor molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04064  NF-kappa B signaling pathway
bacu04217  Necroptosis
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103012352 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103012352 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103012352 (TICAM1)
   04621 NOD-like receptor signaling pathway
    103012352 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103012352 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103012352 (TICAM1)
   05133 Pertussis
    103012352 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103012352 (TICAM1)
   05160 Hepatitis C
    103012352 (TICAM1)
   05164 Influenza A
    103012352 (TICAM1)
   05168 Herpes simplex virus 1 infection
    103012352 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103012352 (TICAM1)
   05165 Human papillomavirus infection
    103012352 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103012352 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 103012352
NCBI-ProteinID: XP_007169217
UniProt: A0A383Z297
LinkDB
Position
Un
AA seq 705 aa
MASTGPSLSGAFDILGAAGQDKLLYLKHKLKTLRPGCRGADLLHAMVLLKLGQETEARIS
LEALKADAVAKLVARQWAGVDSTEAPEEPPDVSRAVARVYHLLAEERLCPAPMREEAYRA
AIRAFRSRDDPQLGELQEEARDRCGWEVLRDLEGIQTLHSDLGCLLPSSASPSGTRSHPR
PIEDLSEWSRGHSLRSTGSPASLASNLEIRQSPTMALLSSHHSPHGPSKLCDKPRPSPVP
EPAPMGCQEPEEMSWPPSVEAARPPARPNSPAPRLPEVAADACPASLHDPPEAPKTSTHH
PGECTDVPAAPKSLPSRSRNACPVADQSPIQLSEEDTTYPAAQPRPPTPSAPKTSSPFSS
PSTPPKAHPTVSKPGPPPPELESPEQKFYNFVVLHAGADEHIALRVRERLEALGVRDGAT
FCEDFQVPGRGELHCLQDALDHSAFTILLLTSNFDCRLSQHQANQSLMSSLTRHGWQDCV
IPFLPLESSLTQLSPSTTSLLNALVWLDEHSPIFAKRVANTFKSQKLRARKAKWRKEQDI
RALQEQSKHLEGEWQQAAAWSAAHSAYLHNYLSYQMQMEKLQVAFGNYMPFETQLPSVPQ
VPFGGPGTLGAPPPPFPTQPGHQPPPLPPWLAGMPPPAFPQPPVAFPQPQAFPQPPDFPQ
TSPVHSQGLQPLIIHHAQMVQLGLNNHMWNQRGMQAPEDKTPETE
NT seq 2118 nt   +upstreamnt  +downstreamnt
atggccagcacaggcccgtccctttctggcgcctttgacattctaggcgcggcgggccag
gataagctcttgtatcttaagcacaaactgaagaccctgcggccaggctgccggggggcg
gacctcctgcatgccatggtgctcctaaagctgggccaggagaccgaggccaggatctcc
ctggaggcgctgaaggcggacgctgtggcgaagctggtggcccgccagtgggctggtgtg
gacagcactgaggccccagaggagcccccagacgtgtcccgggccgttgccagggtgtac
caccttcttgccgaggagaggctgtgtccagcgccaatgcgggaggaggcctaccgcgca
gccatccgtgctttcaggtccagggacgacccccagctgggggagctccaggaagaggca
cgagaccggtgcggatgggaggtccttagggacctggagggcatccaaactctccactcc
gatctggggtgcctcctgccgtcctcggcatcaccctccgggacccgcagccatccgcgg
cccatcgaggacctttcggagtggagcagagggcattccctgagatccaccggcagcccc
gcctccctggccagcaacttggaaattagacagtcgcccaccatggccctcctcagcagt
caccacagcccccacgggcccagcaagctgtgtgacaagccccggcccagcccagtgccc
gagcctgcccctatgggctgccaggagcccgaggagatgagctggcccccatcagtggag
gctgccaggcccccggcgcggccaaacagcccagcccccaggcttcccgaggtggccgca
gatgcatgccccgccagcctgcacgaccccccggaagctccgaaaaccagcactcaccac
ccgggggagtgcacggatgtgccagcagctcccaaatctctcccctcgcgttccagaaac
gcctgccctgtcgcggatcagtcgccaatccaactttcagaggaagacaccacttacccg
gcggctcagccacgcccaccgactccatcggcccccaaaacgtcctctcccttttcgtct
ccatcgacccctcctaaggctcaccctaccgtctcgaagccagggccccctcctcctgag
ctggagtcgccagagcagaaattctataactttgtggtgctgcacgctggcgctgacgag
cacatcgcgttgcgcgtgcgcgagaggctggaggccctgggcgtgcgcgacggcgccacg
ttctgcgaagatttccaggtgccagggcgcggcgagctgcactgcctgcaggacgcctta
gaccactcggccttcaccatcctgttgctcacctccaacttcgactgccggctgagccag
caccaggcgaaccagtctctgatgagcagcctcacgcggcatgggtggcaggattgcgtg
atccccttcctgcccctggagagttccctgacccagctcagccccagcacgaccagcctg
ctcaacgccctggtgtggctggacgagcactccccgatcttcgccaagagggtggccaac
accttcaagtcccagaagctgcgggcccgcaaggccaagtggaggaaggaacaggatatc
cgggccctgcaggagcagagcaaacacctggagggtgagtggcagcaggcagcggcgtgg
agtgccgcgcactcggcttacctccataactacctgtcgtaccagatgcagatggagaag
ctccaggtagctttcgggaactacatgccatttgagactcagctgccttctgtgcctcag
gtgccctttgggggaccggggaccctgggagccccaccaccaccctttcccacccagccg
ggccatcagccgccgcccctgcctccttggctggcgggcatgcccccaccggccttcccg
cagcccccggtggctttcccgcagccccaggccttcccgcagcccccggacttcccacag
acttcacccgtgcactctcaggggctgcagcccctcatcatacaccatgcgcagatggta
caactgggactcaacaaccacatgtggaaccagagagggatgcaggcgcccgaggacaag
acgccagaaacggaatga

DBGET integrated database retrieval system