KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012385
Entry
103012385         CDS       T03086                                 

Gene name
JAK3
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04062  Chemokine signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04217  Necroptosis
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04630  JAK-STAT signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05223  Non-small cell lung cancer
bacu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103012385 (JAK3)
   04151 PI3K-Akt signaling pathway
    103012385 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103012385 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103012385 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103012385 (JAK3)
   04659 Th17 cell differentiation
    103012385 (JAK3)
   04062 Chemokine signaling pathway
    103012385 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012385 (JAK3)
   05203 Viral carcinogenesis
    103012385 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103012385 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    103012385 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103012385 (JAK3)
   05161 Hepatitis B
    103012385 (JAK3)
   05162 Measles
    103012385 (JAK3)
   05169 Epstein-Barr virus infection
    103012385 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103012385 (JAK3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103012385 (JAK3)
Protein kinases [BR:bacu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   103012385 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH Kdo SH2
Other DBs
NCBI-GeneID: 103012385
NCBI-ProteinID: XP_007195541
UniProt: A0A384B744
LinkDB
Position
Un
AA seq 1104 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQCLSFSFGDHSAEELCVWAAKA
SGILPVYHSLFALALEDLSCWFPPSHIFSVEDAGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRNDLVSGRLPMGLSLKEQGECLSLAVLDLAQMALEQGQR
PEELLKTISYKVCLPPGLRDLIQGLSFVTRRRIRRTVRRALRRLAACQADKHSLMAKYIM
DLERLDPDRATETFCVGLPGAAGGQDAPGLLRVAGGSGIAWSPGEHKVLQPFCDFPEIVD
ISIKQAPRIGPAGEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSGHYFC
KEVAPPRLLEQVAEQCHGPITLDFAINKLKTGGSLPGSFVLRRSPQDFDSYLLTVCVPTP
LGPDYKGCLIRCDPTGTFSLAGLGRPHSSLRELLAACWDGGLHVDGVELNLTFCCSPRPK
EKSNLIVVRRDCNPPTSSPVQPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARETEVLLKVMDAKHKNCMESFLEAATLMSQVSYQHLVLLHGVCMAGDGIMVQ
EFVYLGALDTYLRKCGQLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTMPISTLDPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSL
ITSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVSYGPGRLSLRL
VMEYLPSGCLRDFLQRHRARLDAGRLLLYASQICKGMEYLGSRRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFRYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKSCSPSAEFLRMMGCERDAPALCRLLELLAEGQRLPAPPACPGEVHELMKLCWAP
SPQDRPPFSALGPQLDALWSGSQG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacgcccctgatccctcagcgctcctgcagcctctcctct
tcagaggctggtgccctgcacgtgctgctgccccctcggggccctggacccccgcagtgc
ctctccttctcctttggggaccactcagctgaagagctatgtgtttgggctgctaaggcc
agtggcatcctgcccgtgtaccactccctctttgctctggccttggaggacctgtcctgt
tggttccccccgagccacatcttctccgtggaggacgcgggcacccaggtccttgtctac
aggctccgcttttacttccccaactggtttgggctagagaagtgccaccgctttgggcta
cgaaaggacttagccagtgccatccttgacctgccagtcctggagcacctctttgcccag
caccgcaatgacctggtcagcggccgcctcccgatgggccttagcctcaaggagcagggt
gagtgtctcagcttggctgtgctggacctggcccagatggccctcgagcagggtcagcgg
cccgaggagctgctgaagaccatcagctacaaggtctgcctgccccccggcctgcgcgac
ctgatccagggcctgagcttcgtgacgcggaggcgtatccgaaggacagtgcgtcgggcc
ttgcgccgcttggccgcctgccaggctgataagcactcgctcatggccaagtacatcatg
gacctcgagcggctggacccagacagggccaccgagaccttctgcgtgggcctccccgga
gctgctggtggtcaggatgcgccggggctgctccgcgtggctggcggcagtggcatcgcc
tggagcccgggagaacacaaggtcctccagcccttctgcgactttccagaaatcgtggat
atcagcatcaagcaggccccgcgcattggccccgccggggagcaccgcctggtcaccatc
accaggacagacaaccagatcctggaggccgagttcccggggctgcccgcagcgttgtcc
ttcgtggcgctcgtggatggctacttccggctgaccactgactccgggcactacttctgc
aaggaggtggcgccgccgcggctgctggagcaggtggctgagcagtgccatggccccatc
accttggattttgccatcaacaaactcaagactgggggttcacttcctggctccttcgtt
ctccgccgcagtccccaggatttcgacagctacctcctaactgtctgtgtcccgaccccc
ctgggccctgattacaagggctgcctcatccggtgcgaccccacaggaaccttctccctg
gctggccttggccgtccgcacagcagtcttcgagagctcctggcagcctgttgggatggt
gggttgcacgtggatggggttgagctgaacctcaccttctgctgcagccccagacccaaa
gaaaagtccaatctgattgtggtccggagagattgcaacccacccacatcatcccctgtt
cagccccaatcccaatgccagctgagtcagatgacatttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggtcacgggtcctttaccaagatttaccggggctgtcgc
catgaggttgtggatggggaggcccgagagacagaggtgctgctcaaagtgatggatgcc
aagcacaagaactgcatggagtcattcctggaagcagcgaccttgatgagccaagtgtcg
taccagcatctcgtgttgctccatggcgtgtgcatggctggagacggcataatggtgcag
gaatttgtatacctgggagcgctggacacgtatctgcgcaagtgtggccagctggtgccg
gccagctggaagctacaggtgatcaaacagctggcttatgccctcaactatctggaagac
aaaggtctccctcacggcaatgtctcagcccggaaggtgctcctggctcgggagggggct
gacgggaacctgcctttcatcaagctgagtgaccccggtgtcagccccactgtgctaagc
ctggagatgctcactgacaggatcccctgggtggcccctgagtgtctccaggaggcccga
acacttggcttggaagctgacaagtggggctttggtgccacagtctgggaggtgttcagc
ggtgtcacaatgcccatcagcaccctggatcctgccaagaagctccagttttaccaggaa
cggcagcaactgcctgcacccaagtggatggagctggccctgctgatccaacagtgcatg
gcctatgagccaggccagaggccctctttccgcgctgtcatccgtgacctgaacagcctc
atcacttcagattatgagctcctctcagaccccacacctggtgccctggcgccccgtgat
gggctttggaatggtgcccagctctatgcctgccaggaccctaccatctttgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggcagcgtggaactgtgccgc
tatgacccgctgggcgacaacacaggtgccctggtggccgtgaagcagttgcagcacagc
gggccagaacagcagagggacttccagcgggagatccagatcctcaaagccctccacagt
gacttcattgtcaagtaccggggtgtcagctatggcccaggccgcctgagcctgcggctg
gtcatggagtacctgcccagcggctgcctgcgcgacttcctgcagcggcaccgcgcgcgc
cttgacgccggccgcctgctcctctacgcctcgcaaatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggcagcccgtaacatcctggtggagagcgag
acgcatgtcaaaatcgccgacttcggcctcgccaagctgctgccgctcgacaaagactac
tacgtggtccgcgagccaggccagagccccatcttcaggtacgccccagagtccctctcg
gacaacatcttctcgcgtcagtcggacgtctggagcttcggggtcgtcctgtacgagctc
ttcacctacagtgacaagagctgtagcccctcagccgagttcctgcggatgatgggatgc
gagagagatgcgccagccctctgccgcctcttggagctgctggccgagggccagaggctg
cccgcacctcctgcctgtcctggtgaggttcatgagctcatgaagctgtgctgggcccct
agcccacaagaccggccaccattcagcgccctgggcccccagctggatgcactgtggagt
ggaagccagggatag

DBGET integrated database retrieval system