KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012537
Entry
103012537         CDS       T03086                                 

Gene name
MAP2K6
Definition
(RefSeq) mitogen-activated protein kinase kinase 6
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04015  Rap1 signaling pathway
bacu04218  Cellular senescence
bacu04380  Osteoclast differentiation
bacu04620  Toll-like receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04912  GnRH signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05145  Toxoplasmosis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103012537 (MAP2K6)
   04015 Rap1 signaling pathway
    103012537 (MAP2K6)
   04668 TNF signaling pathway
    103012537 (MAP2K6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103012537 (MAP2K6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103012537 (MAP2K6)
   04664 Fc epsilon RI signaling pathway
    103012537 (MAP2K6)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103012537 (MAP2K6)
   04935 Growth hormone synthesis, secretion and action
    103012537 (MAP2K6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103012537 (MAP2K6)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103012537 (MAP2K6)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103012537 (MAP2K6)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103012537 (MAP2K6)
   05022 Pathways of neurodegeneration - multiple diseases
    103012537 (MAP2K6)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103012537 (MAP2K6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103012537 (MAP2K6)
   05135 Yersinia infection
    103012537 (MAP2K6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103012537 (MAP2K6)
   05161 Hepatitis B
    103012537 (MAP2K6)
   05163 Human cytomegalovirus infection
    103012537 (MAP2K6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103012537 (MAP2K6)
   05169 Epstein-Barr virus infection
    103012537 (MAP2K6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103012537 (MAP2K6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103012537 (MAP2K6)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103012537 (MAP2K6)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: STE group
  STE7 family
   103012537 (MAP2K6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal CLP1_P Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 103012537
NCBI-ProteinID: XP_007185643
UniProt: A0A384AEA6
LinkDB
Position
Un
AA seq 368 aa
MPNSQQGEKGRSSWVKRIGSLILTFPPGLVKNLTRDLSLHLGSSAQPGDWSLSFTAVLVG
GKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYG
VVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDV
WICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNV
LINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGI
TMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADEFSDEFADFTSQCLKKNSKERPTY
PELMGNKT
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgccgaactcccagcagggagaaaagggcaggtcttcctgggtaaagagaattggcagc
cttatactgacatttccccccggactggtgaaaaacctcacccgtgacctcagcctgcac
ttgggaagctctgctcagcctggtgactggagcttgtcattcacagccgtcctggtagga
ggcaagaagcgaaaccctggccttaaaatcccgaaagaagcatttgaacaacctcagacc
agttccacgccacctcgagatttagactccaaagcttgcatttctattggaaatcagaac
tttgaggtgaaggcggatgacctggagcctatagtggagctgggccggggggcgtacggg
gtggtggagaagatgcggcatgtgcccagcgggcagatcatggcggtgaagcggatccgg
gccacagtaaatagccaggagcagaaaaggttactgatggatctggatatttccatgagg
accgtggactgtccttttacggtcaccttttatggcgcactcttccgtgagggggatgtc
tggatctgcatggagctcatggacacgtccctagataaattctacaaacaagtgattgat
aaaggccaaacaattccagaggacatcttagggaaaatagcagtttctattgtaaaagca
ttagaacatttacacagtaagctctctgtcattcatcgagatgtcaagccttccaatgtg
ctcatcaacaccctgggccaggtgaagatgtgcgattttgggatcagcggctaccttgtt
gactctgtcgctaaaactattgatgcaggatgcaaaccgtacatggcccccgagagaata
aacccagagctcaaccagaagggatacagcgtgaagtccgacatttggagtctgggcatc
accatgatcgagctggccatccttcggtttccctatgactcgtggggaaccccttttcag
cagctcaaacaggtggtggaggagccgtcgccacaactccccgcagacgagttctccgac
gagtttgccgacttcacctcgcagtgcttgaagaagaattccaaagaaaggccaacatat
ccagagcttatgggaaataaaacctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019100
Entry
103019100         CDS       T03086                                 

Gene name
MAP2K3
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04015  Rap1 signaling pathway
bacu04218  Cellular senescence
bacu04620  Toll-like receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04714  Thermogenesis
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04912  GnRH signaling pathway
bacu04935  Growth hormone synthesis, secretion and action
bacu05014  Amyotrophic lateral sclerosis
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05145  Toxoplasmosis
bacu05161  Hepatitis B
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103019100 (MAP2K3)
   04015 Rap1 signaling pathway
    103019100 (MAP2K3)
   04668 TNF signaling pathway
    103019100 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103019100 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103019100 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    103019100 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103019100 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    103019100 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103019100 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103019100 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103019100 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103019100 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    103019100 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103019100 (MAP2K3)
   05135 Yersinia infection
    103019100 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103019100 (MAP2K3)
   05161 Hepatitis B
    103019100 (MAP2K3)
   05169 Epstein-Barr virus infection
    103019100 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103019100 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103019100 (MAP2K3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103019100 (MAP2K3)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: STE group
  STE7 family
   103019100 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH RIO1 Choline_kinase
Other DBs
NCBI-GeneID: 103019100
NCBI-ProteinID: XP_007174262
UniProt: A0A383ZGP3
LinkDB
Position
Un
AA seq 347 aa
MESPAASQPAGVPASKGKSRRKKDLRISCVSKPPAPSPTPPRNLDSRAFITIGDRNFEVE
ADDLVAISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDVNMRTVDC
FYTVTAIPDAHVQGDVWICMELMDTSLDKFYRKVLDKDMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTSHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaatctcctgccgcgagccagcccgccggggtgcccgcgtccaaaggaaagtccagg
aggaagaaggatttacgaatctcctgcgtgtccaagccgccggcgcccagccccacgccc
ccccggaacctggactcccgggccttcatcaccatcggggacaggaactttgaggtggag
gcggatgacctggtcgccatctcggagctgggccggggcgcctacggggtagtggagaag
gtgcggcacgcccagagtggtaccatcatggccgtgaagcgcatccgggccaccgtgaac
tcgcaggagcagaagcgcctgctcatggacttggacgtgaacatgcgcacggtcgactgc
ttctacaccgtgacagcgattccggatgcccacgtgcagggagacgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctggacaaggacatgacg
atcccggaggacattctcggggaaatcgctgtatctattgtgagggccctggagcacctg
cacagcaagctgtccgtgatccacagagacgtgaagccgtccaacgtcctcatcaacaag
gagggccacgtgaagatgtgcgactttgggatcagtggctacctggtggattccgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccggagctg
aaccagaaaggctacaatgtcaagtccgacgtctggagcctcggcatcaccatgatcgag
atggccatcctgcggtttccttatgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccgcagctcccagctgaccgcttctcccccgagtttgtggac
ttcactgcacagtgcctgagaaagaaccctgcggaacgcatgagctacctggagctgatg
gaacaccctttcttcacctcgcacaaaaccaagaagaccgacatcgctgcctttgtgaag
gagatcctgggagaggactcgtag

DBGET integrated database retrieval system