KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012774Help
Entry
103012774         CDS       T03086                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bacu01002]
    103012774 (TMPRSS9)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103012774 (TMPRSS9)
Peptidases [BR:bacu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103012774 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 103012774
NCBI-ProteinID: XP_007176734
UniProt: A0A383ZP84
LinkDB All DBs
Position
Un
AA seq 1014 aa AA seqDB search
MEPTAGDVQLVPRATKDIQATDAACCRAALSAMVATSIVMVTLGVLVASLSTQGVNVEHT
AELRGIRFAPSLQQETSDYYRTLTPTLETLLHFMQPALRTPSPGLEEELLQRGLRERLQG
RGIPLAPYGTIVSAQLTGDQKGPLTERDLKSGRCPGNAFSCGNSQCVTKVNPECDDTADC
SDGSDEAHCDCGLQPGWRTAGRIVGGVEASPGEFPWQVSLRENNEHFCGAAIIGARWLVS
AAHCFNEFQDPTEWVAYAGSTYLSGSEASTVRARVARIITHPFYNSDTADFDVAVLELGG
PLPFSRHVQPVCLPAAVHVFPPRKKCLISGWGYLKEDFLVKPEMLQKATVELLDQALCAS
LYGHSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARHPGV
YARVTRLRDWILEAIAAASKPPAPTAAPAPAIPSTAWPTSPQSPVVNTPTRPTLAPSAVP
LDSATASKPQECGARPALEKPTRIVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLL
SAAHCFNHTKVELVWAHLGSASLSGVGGGPVEMGLRRAVLHPQYNPSILDFDVAVLELAR
PLVFNKYVQPVCLPLAIQKFPVGRKCVISGWGNTQEGNATKPDLLQRASVGIIDQKACSA
LYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEEMPGVFYLAGIVSWGIGCAQARKPGV
YTRITRLKGWILAIMSSHSLGTPPPSTTRTPTSSHPARTTAGLTVLGVVASRPTPWVTSR
VTSQPANRTTTAMTTTTRGQTPLPHATETTVGSQPPGTQRNGVRWVGGGSPVSVAGAAVT
ASQSGDGDGGVGPISKSPILRFWGSGLPLMNFGGDTSQTIVGPDGRDPTLTGQHRCGAVL
VAERWLLSAAHCFDVGSMARQLQKAAVRLLSEQMCRRFYPVQISSRMLCAGFPQGGVDSC
SGDAGGPLACREPSGRWVLTGITSWGYGCGRPQFPGVYTRVAAVRGWIGQNIQE
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgccggtgacgtacagctggtgcccagggcaaccaaggacatccaggct
acagacgccgcatgctgccgggcagccctctcggccatggtggccaccagcatcgtcatg
gtcaccctgggagtcctcgtggcctccctctctacacagggtgtcaatgtggagcacaca
gccgagctgcgagggatccggtttgcccccagcttgcagcaggagacctcagactattac
cgcacgctgacacccactctggaaacgctgctgcactttatgcagccggccctgcggaca
ccgagcccgggcctggaggaggagctgctgcagcggggactccgagagaggctgcagggc
cgcggcatccccctggccccctatggcaccatcgtgtccgcccagctcacaggcgaccag
aaggggccgctgacagaaagagacttaaaatcaggtcgctgtccagggaacgccttttcc
tgcgggaacagccagtgtgtgaccaaggtgaaccccgagtgtgatgacacagcggactgc
tccgacggctccgatgaggcccactgtgactgtggtttgcagcctggctggaggacagcc
ggcaggattgtgggcggcgtggaggcatccccgggggagttcccttggcaagtcagcctc
cgggaaaacaacgaacacttctgcggggccgccatcattggcgccaggtggctggtgtct
gctgcccactgcttcaatgagttccaagaccccaccgagtgggtggcttacgcgggaagc
acctacctcagcggctcggaggccagcacggtgcgggcccgagtggcccggatcatcacg
caccccttctacaactctgacacggccgacttcgacgtggcggtgctcgagctgggtggc
cccctgcccttcagcaggcatgtgcagcccgtgtgcctcccggccgccgtgcacgtcttc
ccgcccaggaagaagtgtctgatctcgggctggggctacctcaaggaggatttcctggtc
aagccggagatgctgcagaaagccaccgtggagctgctggaccaggccctgtgcgccagc
ctgtatggccactcgctcaccgacaggatgctgtgtgccggctacctggatgggaaggtg
gattcctgccagggcgactcggggggccccctggtctgcgaggagccctccggaaggttc
ttcctggccggcatcgtgagctggggaatcggctgtgcagaagcccggcatccgggggtg
tacgcccgagtgaccaggctgcgtgactggatcctggaggccattgccgctgcgagcaag
cctccggcccccacggcggctcctgccccggccatccccagcaccgcctggcccaccagc
ccccagagcccggtggtcaacacacccaccagacccacgctggcccccagcgccgtgcct
cttgactcagccactgcttctaagccacaagagtgcggggccaggccggcgctggagaag
cccacccggatcgtgggcgggttcggggccgcgtccggggaggtaccctggcaggtcagc
ctgaaggagggttcccggcacttctgcggggccaccgtggtaggggaccgctggctgctg
tctgccgcccactgcttcaaccacacgaaggtggaactggtgtgggcccacctgggctcc
gcgtccctctcgggcgtcggcgggggccccgtggagatggggctcaggcgggcggtgctg
cacccccagtacaatcccagcatcctggacttcgacgtggccgtgctggagctggccagg
cccctggtcttcaacaagtacgtgcagcctgtctgcctgcccctggccatccagaagttc
cccgtgggccgcaagtgcgtgatctctggatggggcaacacgcaggagggaaacgccacc
aagcctgacctcctgcagcgggcatccgtgggcatcatagaccagaaggcatgcagtgcc
ctctacaacttctcgctcacggacaggatgatctgtgcggggttcctggagggcaaggtt
gactcctgccagggtgactctgggggacccctggcctgtgaggagatgcctggcgtgttc
tatctggcggggatcgtgagctggggcatcggctgtgctcaggccaggaagccgggcgtg
tacacccgaatcacccggctgaagggctggatcctggccatcatgtcctcccactccctc
ggcacgcccccgccgtccaccacgaggacgcccaccagcagtcaccctgccaggacgacg
gctggcctcacggtcctgggggtcgtggccagcagacccaccccctgggtcaccagcagg
gtgaccagccaacctgccaacaggaccaccactgccatgaccaccaccaccaggggacag
acaccacttccacatgccacggagaccaccgtgggctcccagccaccaggtacccagaga
aatggagtgaggtgggtgggtggcgggagtcctgtgtcagttgctggggctgctgtcaca
gcgtcccagtcgggggatggagatggaggtgtcggccccatctccaaaagtcccatcctg
aggttctgggggtcagggcttccacttatgaattttggaggggacacaagtcagaccatc
gtaggccccgacggcagggacccgacactgacagggcagcaccgctgcggggccgtgctc
gtggccgagaggtggctgctgtcggcggcgcactgcttcgacgtaggctcgatggcccgg
cagctgcagaaggcggccgtgcgcctcctcagcgagcagatgtgccgccgcttctacccg
gtgcagatcagcagccgcatgctgtgcgcgggcttcccgcagggcggagtggacagctgc
tcgggtgacgctgggggacccctggcctgcagggagccctctggccgctgggtgctaact
gggatcaccagctggggttacggctgtgggcgaccccagttcccgggcgtctacacccgg
gtggctgctgtgagaggttggatcgggcagaacatccaagagtga

DBGET integrated database retrieval system