KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012968
Entry
103012968         CDS       T03086                                 

Gene name
CDKN2A
Definition
(RefSeq) cyclin dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04218  Cellular senescence
bacu04934  Cushing syndrome
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103012968 (CDKN2A)
   04115 p53 signaling pathway
    103012968 (CDKN2A)
   04218 Cellular senescence
    103012968 (CDKN2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012968 (CDKN2A)
   05206 MicroRNAs in cancer
    103012968 (CDKN2A)
   05203 Viral carcinogenesis
    103012968 (CDKN2A)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103012968 (CDKN2A)
   05225 Hepatocellular carcinoma
    103012968 (CDKN2A)
   05214 Glioma
    103012968 (CDKN2A)
   05220 Chronic myeloid leukemia
    103012968 (CDKN2A)
   05218 Melanoma
    103012968 (CDKN2A)
   05219 Bladder cancer
    103012968 (CDKN2A)
   05223 Non-small cell lung cancer
    103012968 (CDKN2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103012968 (CDKN2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103012968 (CDKN2A)
   05163 Human cytomegalovirus infection
    103012968 (CDKN2A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103012968 (CDKN2A)
   01522 Endocrine resistance
    103012968 (CDKN2A)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Other DBs
NCBI-GeneID: 103012968
NCBI-ProteinID: XP_007176887
UniProt: A0A383ZP52
LinkDB
Position
Un
AA seq 109 aa
MMMGSARVAELLLLHGADPNCADPDTLTRPVHDAAREGFLDTLVALHRAGARLDVRDAWG
RLPVDLAEERGHRDVARYLRAAAGGTEGGSHARADSAEGPADSPALKNH
NT seq 330 nt   +upstreamnt  +downstreamnt
atgatgatgggcagcgcccgcgtggccgagctgctgctgctccacggtgcggaccccaac
tgcgcggaccccgacaccctcacccgacccgtgcacgacgcggcccgggagggcttcctg
gacacgctggtggcgctgcaccgagccggggcgcggctggacgtgcgcgacgcctggggc
cgcctgcccgtggacctggctgaggagcggggccaccgcgacgtcgcccgctacctgcgc
gcggctgcagggggcaccgaaggcgggagccacgcccgcgcagactccgcggaaggtccc
gcagacagtcccgccctaaagaatcattga

DBGET integrated database retrieval system