KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013134
Entry
103013134         CDS       T03086                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin A1
  KO
K06627  cyclin-A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04110  Cell cycle
bacu04152  AMPK signaling pathway
bacu04218  Cellular senescence
bacu04914  Progesterone-mediated oocyte maturation
bacu05161  Hepatitis B
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103013134 (CCNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103013134 (CCNA1)
   04218 Cellular senescence
    103013134 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103013134 (CCNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013134 (CCNA1)
   05202 Transcriptional misregulation in cancer
    103013134 (CCNA1)
   05203 Viral carcinogenesis
    103013134 (CCNA1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103013134 (CCNA1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103013134 (CCNA1)
   05161 Hepatitis B
    103013134 (CCNA1)
   05169 Epstein-Barr virus infection
    103013134 (CCNA1)
   05165 Human papillomavirus infection
    103013134 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bacu03032]
    103013134 (CCNA1)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103013134 (CCNA1)
DNA replication proteins [BR:bacu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103013134 (CCNA1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103013134 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103013134
NCBI-ProteinID: XP_007193703
UniProt: A0A384B2B1
LinkDB
Position
Un
AA seq 421 aa
MHLHSSKSGVVLAPVSRGPDACQMITRAQLGQDPPQRTVLGVLTENGQYRRTCGQGITTL
RCFSGSENVFPPAGKEVLSDSRVQVPAKQGFDMYMDKPEQGDRNSCTGREGMAFEDAYEV
HTSTLKSDLHFLLDFNTVSPMLVDPSLHSQSEDASDSGTDVINVTEYAEEIHQYLREAEM
RHRPKVHYMRKHPDITEGMRTILVDWLVEVGEEYNFRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAALLLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAYCLANYTVNRHFW
PETLATFTGYSLSEIVPCLSELHKVCLGITHRPQQAIREKYKASKYMHVSLVEPPAVLPL
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatctccacagctccaagagcggagtagtgctggctccagtgtcccgaggtcctgat
gcctgtcagatgataaccagagcccagcttggccaggatccgccacaaagaacagtacta
ggggtgctaactgagaatgggcagtacaggaggacctgtggccaggggatcacaacactc
aggtgtttctctgggtcagaaaatgtcttccctccagctggaaaggaagtgctgtctgac
agccgggttcaggtgccagccaagcaaggatttgacatgtacatggacaagcctgagcaa
ggggacagaaacagctgcacagggcgagaggggatggcatttgaggatgcctatgaagta
cacaccagcacactcaagtcagaccttcacttcctgctggattttaacacagtttcccct
atgctggtagatccatctctccactcccagtctgaagatgcatcagattctggtacagat
gtgataaatgtgactgaatatgctgaagaaattcatcagtaccttagagaagctgaaatg
agacacaggcccaaagtgcactacatgaggaaacacccagacatcacagaaggcatgcga
acgattctggtagactggctggttgaggtgggagaagaatataactttcgggcagagact
ctctacctggccgtcaacttcctggacaggtttctttcctgcatgtctgttctgagaggg
aaactgcagcttgtaggaacagcagctcttctcctggcttcgaaatatgaagaaatatat
ccacctgaagtagatgagtttgtctatataactgatgatacctacacaaaacgacaactg
ctgagaatggaacacctgctcctgaaagtcctggcttttgacctgacagtgccaaccacc
aaccagtttctccttcagtacttaaggaggcaaggagtgtgtgtcaggactgagaacctg
gccaagtatgtagcagaactgagtctccttgaagctgacccattcttgaaataccttcct
tcactgatcgctgcagctgcttattgcctggcaaactatactgtgaacaggcacttctgg
ccagaaacccttgctacgtttacaggctattcattaagtgaaattgtgccttgcctgagt
gagctgcataaagtgtgcctgggtataacccatcgacctcagcaagcgattagggagaag
tacaaggcttcaaagtacatgcacgtgtctctcgtggaaccacccgcagtccttcctcta
cgataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019807
Entry
103019807         CDS       T03086                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin A2
  KO
K06627  cyclin-A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04110  Cell cycle
bacu04152  AMPK signaling pathway
bacu04218  Cellular senescence
bacu04914  Progesterone-mediated oocyte maturation
bacu05161  Hepatitis B
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103019807 (CCNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103019807 (CCNA2)
   04218 Cellular senescence
    103019807 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103019807 (CCNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019807 (CCNA2)
   05202 Transcriptional misregulation in cancer
    103019807 (CCNA2)
   05203 Viral carcinogenesis
    103019807 (CCNA2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    103019807 (CCNA2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103019807 (CCNA2)
   05161 Hepatitis B
    103019807 (CCNA2)
   05169 Epstein-Barr virus infection
    103019807 (CCNA2)
   05165 Human papillomavirus infection
    103019807 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bacu03032]
    103019807 (CCNA2)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103019807 (CCNA2)
DNA replication proteins [BR:bacu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    103019807 (CCNA2)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103019807 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C
Other DBs
NCBI-GeneID: 103019807
NCBI-ProteinID: XP_007172465
UniProt: A0A383ZBE3
LinkDB
Position
Un
AA seq 435 aa
MLGSSAPGPAAREAGSALLTLQQTALQEDQENQENINPEKAAPTQQPRTRAGLAVLKAGN
SRGPAPQQRPKTRRVAPLKDLPVNDEHVTVPAWKANSQQPAFTIHVDAAEEETQKRPAES
KKPEGEDVLAFNSALTLPGPRKPLVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPD
YHEDIYTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVN
YIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHL
VLKVLAFDLAAPTINQFLTQYFLHQQSANCKVESLAMFLGELSLIDADPYLKYLPSVIAA
AAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLMDLHQTYLRAPRHAQQSIREKYKNSK
YHGVSLLNPPETLNV
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgttgggcagctccgcgcccgggcctgcggcccgcgaggcaggctcggcgctgttaaca
ttgcagcagacggcgctccaggaggaccaggagaaccaggagaacatcaaccccgagaag
gcggcgcccacccagcagccccggacccgcgctgggctggcggtactgaaggccgggaac
tcgcggggaccagcgccgcagcagaggcctaagacgcgacgggttgcacctcttaaggac
cttcctgtaaatgatgagcatgtcaccgttcctgcctggaaagcaaacagccagcagcct
gcgtttaccattcacgtggatgcagcagaggaagagactcagaagaggccagctgaatct
aaaaaaccagaaggtgaagatgtcttggcttttaactcagctcttactttaccaggacca
agaaaaccactggtacctcttgattacccaatggatggtagttttgagtcaccacatact
atggatatgtcaattgtattggaagatgaaaagccagtgagtgttaatgaagtaccagac
taccatgaggacatttacacataccttagggaaatggaggttaaatgtaagcctaaagtg
ggttacatgaagaaacagccagacattactaacagtatgagggctatcctcgtggactgg
ttagttgaagtaggagaagaatataaactacagaatgagaccctgcatttggctgtgaac
tacattgataggtttctttcatcaatgtctgtgttgagaggaaaacttcagcttgtgggc
actgctgctatgctgttagcctcaaagtttgaagaaatataccccccagaagtagcagaa
tttgtatacattacagatgacacttataccaagaaacaagttctgagaatggagcaccta
gttttgaaagtccttgcttttgacttagctgcaccaacaataaatcagtttcttacccag
tactttctgcaccagcagtctgcaaactgcaaagttgaaagtttagcaatgtttttggga
gagttaagtttgatagatgctgacccatatctaaagtatttgccatcagttatcgccgca
gcagccttccatttagcactctacactgtcacgggacaaagctggcctgaatcattagta
caaaagactggatatacgctggaaactctaaagccttgtctcatggaccttcaccagacc
tacctcagagctccgcggcatgcacaacagtcaataagagaaaagtacaaaaactcaaag
tatcatggtgtttctctcctcaacccaccagagacactaaatgtgtaa

DBGET integrated database retrieval system