KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013204
Entry
103013204         CDS       T03086                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04014  Ras signaling pathway
bacu04390  Hippo signaling pathway
bacu04392  Hippo signaling pathway - multiple species
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05219  Bladder cancer
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103013204 (RASSF1)
   04390 Hippo signaling pathway
    103013204 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    103013204 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013204 (RASSF1)
   05206 MicroRNAs in cancer
    103013204 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103013204 (RASSF1)
   05223 Non-small cell lung cancer
    103013204 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1
Other DBs
NCBI-GeneID: 103013204
NCBI-ProteinID: XP_007168958
UniProt: A0A383Z1D8
LinkDB
Position
Un
AA seq 295 aa
LVPGRGHRFQPAGPTTHTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPR
DLGWEPALERDTNVDEPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIK
VQLKLVRPVSVPASKKPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREV
IEALLRKFLVVDDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKE
NDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 888 nt   +upstreamnt  +downstreamnt
ctggtcccaggccgcggccaccgcttccagcccgcggggcccactacgcacacatggtgc
gacctctgtggcgacttcatctggggcgtcgtgcgcaagggcctgcagtgcgcacattgc
aagttcacttgccactaccgttgccgcgcgctcgtctgcctagactgctgcggaccccgg
gacctgggctgggaaccggcgctggagcgggacacgaatgtggatgagcccgtggagtgg
gagacacctgacctttctcaggctgagattgagcagaagatcaaggagtacaatggccag
atcaacagcaacttgttcatgagcctgaacaaggatggctcctacacaggcttcatcaag
gttcaactgaagctggtgcgccctgtctcagttcccgccagcaagaagccaccctccttg
caggatgcccggcggggcccagggcggggtacagctgtgaaacgccgcacctccttctac
ctgcccaaggatgctgtcaagcacttgcatgtgttgtcacgcacacgggcacgcgaggtc
atcgaggccctgctgcgcaagttcttggtggtggatgacccccgcaagtttgcacttttt
gagcgggctgagcgccatggccaagtgtacctccggaagctgtcagatgatgagcagccc
ctacggctacggctccttgcagggcccagtgagaaggccctaagctttgtcctgaaggag
aatgactctggggaggtgaactgggatgctttcagcatgcctgagctacacaacttccta
cgcatcctgcagcgggaggaagaggaacacctccgccagatcctgcagaagtactcgtat
tgtcgccagaagatccaggaagccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system