KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013227Help
Entry
103013227         CDS       T03086                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04110  Cell cycle
bacu04114  Oocyte meiosis
bacu04120  Ubiquitin mediated proteolysis
bacu04914  Progesterone-mediated oocyte maturation
bacu05166  Human T-cell leukemia virus 1 infection
Module
bacu_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103013227 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103013227 (CDC23)
   04114 Oocyte meiosis
    103013227 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103013227 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    103013227 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bacu04121]
    103013227 (CDC23)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103013227 (CDC23)
Ubiquitin system [BR:bacu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     103013227 (CDC23)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    103013227 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 103013227
NCBI-ProteinID: XP_007172279
LinkDB All DBs
Position
Un
AA seq 597 aa AA seqDB search
MAASSSVVPVAVSAAVVSALSSSGDFSNLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLSELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASACAQKCCAFN
DTREEGKALLRQILQLRNQGETPSTEIPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgccagctcctctgtagtcccggtggcagtgtcggctgctgtggtctccgccctg
tcatcgagcggcgatttctcaaatttgcgggaaattaaaaagcagctgctacttatcgcg
ggccttacccgggagcggggcctactgcacagtagcaaatggtctgcggagttggccttc
tccctcccggcgttgcctctgtccgagctgcagcctccgccgcctattacagaggaggat
gcccaggatatggatgcttacaccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctatttcctgtacatgtat
tctagatatctgtctggagaaaagaagaaggatgatgaaacagttgatagcctaggcccc
ctggagaaaggtcaagtgaaaaatgaggctcttagagaattgagagtggagctcagcaaa
aaacaccaggctcgggaacttgatggatttggcctttatctgtatggtgtggtgcttcga
aagctggacttggtgaaagaggccattgatgtgtttgtggaggctactcatgttttgcct
ttgcattggggagcctggctagaactctgtaacttgattacagacaaggagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatatcgac
aaagccctctctatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatctgagttgagttatctggct
cacaacctctgtgagattgataaatatcgtgtagaaacatgctgtgtaattggcaattat
tatagtttgcgttctcagcatgagaaagcagccttgtatttccagagagcactgaaattg
aatcctcggtatcttggtgcctggacgctgatgggacatgagtacatggaaatgaagaac
acatctgccgctattcaggcttataggcatgctattgaggtcaataagcgggactacaga
gcctggtatggccttgggcagacctatgaaatccttaagatgccattttattgcctttat
tattatagacgagcccaccagcttcggcccaatgattctcgtatgctggtcgctttagga
gaatgttatgagaaactcaatcaactagtggaagccaaaaagtgctattggagagcttat
gctgtgggagatgtggaaaagatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggcagcccaatgttacatcaaatatatccaggatatctattcgtgt
ggggaaatagtggaacacttggaggagagcactgctttccgctatctggcccagtattat
tttaagtgcaagctgtgggatgaagcttcagcttgtgcccagaagtgctgtgcattcaat
gatacccgggaagaaggtaaggccttgctccggcaaatcctacagcttcggaaccaaggc
gagactccctccaccgagattcctgctccctttttcctccctgcttcactgtctgctaac
aacactcccacacgtagagtttctccactcaacctgtcttcagtcacaccatag

DBGET integrated database retrieval system