KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013388
Entry
103013388         CDS       T03086                                 

Gene name
PTK2
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04062  Chemokine signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04670  Leukocyte transendothelial migration
bacu04810  Regulation of actin cytoskeleton
bacu04935  Growth hormone synthesis, secretion and action
bacu05100  Bacterial invasion of epithelial cells
bacu05135  Yersinia infection
bacu05146  Amoebiasis
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05205  Proteoglycans in cancer
bacu05222  Small cell lung cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103013388 (PTK2)
   04370 VEGF signaling pathway
    103013388 (PTK2)
   04151 PI3K-Akt signaling pathway
    103013388 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103013388 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103013388 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103013388 (PTK2)
   04062 Chemokine signaling pathway
    103013388 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103013388 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    103013388 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013388 (PTK2)
   05202 Transcriptional misregulation in cancer
    103013388 (PTK2)
   05205 Proteoglycans in cancer
    103013388 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103013388 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103013388 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103013388 (PTK2)
   05100 Bacterial invasion of epithelial cells
    103013388 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103013388 (PTK2)
   05163 Human cytomegalovirus infection
    103013388 (PTK2)
   05165 Human papillomavirus infection
    103013388 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103013388 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103013388 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103013388 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103013388 (PTK2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103013388 (PTK2)
Protein kinases [BR:bacu01001]
 Non-receptor tyrosine kinases
  FAK family
   103013388 (PTK2)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103013388 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 103013388
NCBI-ProteinID: XP_007166948
UniProt: A0A383YVP0
LinkDB
Position
Un
AA seq 1140 aa
MLLEVTGRGALGPTGAVCMEKSGCSPFPVCWAKEYDRYLASSRIMAAAYLDPNLNHTPNS
STKTHLGTGVERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESVLKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTL
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVHGATQSFIIRPQKEGERALPSIPKL
ANSEKQGVRTHAVSVSGVSHCQHKVKKARRFLPLVFCSHEPPSADEISGDETDDYAEIID
EEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGAYTSPENPALAVAIKT
CKNCTSDSVREKFLQEALTMRQFDHPHVVKLVGVITENPVWIIMELCTLGELRSFLQVRK
YSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDST
YYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRI
ENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMES
RRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFHPSPQHMVQTNHYQVSGYPGSHGITA
MAGSIYPGQAPLLDQTDSWNHRPQEIAMWQPNVEDSATLDLRGIGQVLPTHLMEERLIRQ
QQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGGPQGPTGNQHIYQPVGKPDPAAPPKK
PPRPGAPGHLSSLASLGSPGDNYNEGVKPWRLQPQEISPPPTANLDRSNDRVYENVTGLV
RAVIEMSSRIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNS
DLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKALGQTRPH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgttgttggaagtgacgggccgaggggccctgggacccacaggtgctgtctgtatggag
aagagcggctgtagtccatttccagtgtgttgggctaaagaatatgacagatacctagca
tctagcagaataatggcagctgcttaccttgacccaaacttgaatcacacaccgaattca
agtaccaagactcacctgggtaccggtgtggaacgttcccctggggccatggagcgagtg
ttgaaggtctttcattattttgaaagcaacagtgagccaaccacttgggccagtattatc
aggcatggagatgctactgacgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgcctcagtcacctgcggtcagaggaggttcac
tggctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcacaccca
ccagaggagtggaaatatgagttgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagacaagccaactctgaatttcttctatcaacaggtgaagagtgattatatg
ttggagatcgctgatcaagtggaccaggacattgctttgaagttgggttgtctagaaata
cggcggtcgtactgggagatgcggggcaacgccctggagaagaagtctaactatgaagta
ttagaaaaagatgttggtttgaagcgattttttcctaggagtttactggattcagtcaag
gccaaaacactaagaaaattgatccaacaaacatttagacagtttgccaaccttaataga
gaagaaagtgttttgaaattctttgagatcctctccccagtgtacagatttgataaagaa
tgcttcaagtgtgcccttggttcaagctggattatttcggtggagctggcgattggcccc
gaagaaggaatcagttacctcacagacaagggctgcaaccccacacacctggccgacttc
aatcaagtgcagaccattcagtattcaaacagcgaagacaaggacaggaaagggacgctg
cagctgaagatcgcaggagcgcccgagcctctgacggtgacagcaccgtccctgaccatc
gccgagaacatggccgacctgatagacgggtactgccggctggtgcacggggccacgcag
tctttcatcatcaggccccagaaagaaggtgaacgggctttgccatcgataccaaagctg
gccaacagcgagaagcagggcgttcggacccacgccgtctccgtgtcaggagtcagtcac
tgccaacataaagttaagaaagctaggcgctttctccctttggtcttctgttcccacgaa
cctccttctgctgatgaaattagtggggacgaaacagacgactatgctgagattatcgac
gaagaagatacctacaccatgccctcgaaaagctatggaatagatgaagccagggactat
gagattcagagagaaagaatagaactcggacggtgcattggagagggccagtttggagac
gtgcaccaaggcgcttacacaagcccggagaatccagctttggcggttgcaattaaaaca
tgtaaaaactgtacttcggacagcgtgagagagaaattccttcaagaagccttaacgatg
cgccagtttgaccaccctcacgtcgtgaagctggtcggagtcatcacagagaaccccgtc
tggatcatcatggagctgtgcacgctcggagagctgaggtcatttctgcaagtaaggaaa
tacagtttggatctagcatctctgatcctctatgcctatcagcttagcacagcccttgcg
tacctagagagcaaaagatttgtgcacagggacattgctgctcggaatgttctggtgtcc
tcaaacgattgtgtaaaattaggagactttggattatcccgatatatggaagacagtact
tactataaagcttccaaaggaaaattgcctattaaatggatggctccagagtcaatcaat
tttcgccgttttacctcagctagtgacgtatggatgtttggggtgtgtatgtgggagata
ctgatgcacggtgtgaagccctttcaaggcgtgaagaacaatgatgtgatcggccgcatt
gagaatggggagaggttgcccatgcctccgaactgccctcccacgctctacagcctcatg
accaagtgctgggcctacgaccccagccggcggccccgcttcactgagctcaaagctcag
ctcagcacaatcctggaggaggagaaggtccagcaagaagaacggatgaggatggagtcc
agaaggcaggtcacagtgtcctgggactccggagggtccgacgaagcaccacccaagccc
agcagacctggttatcctagtccgaggtccagcgaagggtttcatcccagcccacagcac
atggtacagaccaatcactaccaggtctctggctaccctggctcacatggaatcacagcc
atggctggcagcatctacccaggtcaggcacctcttttggaccaaacagattcgtggaat
cacagaccacaggagatagcgatgtggcagcccaacgtggaggactctgccacactggac
ctgcgtggcatcgggcaggtgttgccgacccaccttatggaggagcggctgatccggcag
cagcaggagatggaagaggatcagcgctggctggagaaggaggagaggtttctgaaacct
gacgtgcggctctctcgaggcagcatcgacagggaggatggaggtcctcagggcccgact
ggaaaccagcacatatatcagcctgtgggcaaaccagatcctgcagctccaccaaagaaa
ccaccgcgtcccggagcccccgggcacctgagcagcctggccagcctcggcagccccggg
gacaattacaatgagggtgtcaagccgtggaggcttcagccccaggaaatcagcccccct
cccaccgccaacctggaccgctccaatgacagggtgtacgagaacgtgacgggcctggtg
agagcggtcatcgagatgtccagcaggatccagccagccccgccagaggagtatgtcccc
atggtgaaggaagtcggcttggccctgaggacgctgttggccaccgtggatgagaccatt
cccgtcctgcctgccagcacccaccgagagattgagatggcccagaagctgctgaactct
gacctgggggagctcatcaacaagatgaagctggcccagcagtacgtcatgaccagcctg
cagcaggagtacaagaagcagatgctgacggccgcacacgccctggccgtggacgccaag
aacctgctcgatgtcatcgaccaggccagactgaaggccctggggcagacgaggccgcac
tga

DBGET integrated database retrieval system