KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013404
Entry
103013404         CDS       T03086                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04340  Hedgehog signaling pathway
bacu04371  Apelin signaling pathway
bacu04390  Hippo signaling pathway
bacu04510  Focal adhesion
bacu04530  Tight junction
bacu04630  JAK-STAT signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103013404 (CCND1)
   04340 Hedgehog signaling pathway
    103013404 (CCND1)
   04390 Hippo signaling pathway
    103013404 (CCND1)
   04371 Apelin signaling pathway
    103013404 (CCND1)
   04630 JAK-STAT signaling pathway
    103013404 (CCND1)
   04068 FoxO signaling pathway
    103013404 (CCND1)
   04151 PI3K-Akt signaling pathway
    103013404 (CCND1)
   04152 AMPK signaling pathway
    103013404 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103013404 (CCND1)
   04115 p53 signaling pathway
    103013404 (CCND1)
   04218 Cellular senescence
    103013404 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103013404 (CCND1)
   04530 Tight junction
    103013404 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103013404 (CCND1)
   04921 Oxytocin signaling pathway
    103013404 (CCND1)
   04919 Thyroid hormone signaling pathway
    103013404 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013404 (CCND1)
   05206 MicroRNAs in cancer
    103013404 (CCND1)
   05205 Proteoglycans in cancer
    103013404 (CCND1)
   05203 Viral carcinogenesis
    103013404 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103013404 (CCND1)
   05212 Pancreatic cancer
    103013404 (CCND1)
   05225 Hepatocellular carcinoma
    103013404 (CCND1)
   05226 Gastric cancer
    103013404 (CCND1)
   05214 Glioma
    103013404 (CCND1)
   05216 Thyroid cancer
    103013404 (CCND1)
   05221 Acute myeloid leukemia
    103013404 (CCND1)
   05220 Chronic myeloid leukemia
    103013404 (CCND1)
   05218 Melanoma
    103013404 (CCND1)
   05219 Bladder cancer
    103013404 (CCND1)
   05215 Prostate cancer
    103013404 (CCND1)
   05213 Endometrial cancer
    103013404 (CCND1)
   05224 Breast cancer
    103013404 (CCND1)
   05222 Small cell lung cancer
    103013404 (CCND1)
   05223 Non-small cell lung cancer
    103013404 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103013404 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103013404 (CCND1)
   04934 Cushing syndrome
    103013404 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103013404 (CCND1)
   05162 Measles
    103013404 (CCND1)
   05160 Hepatitis C
    103013404 (CCND1)
   05163 Human cytomegalovirus infection
    103013404 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103013404 (CCND1)
   05169 Epstein-Barr virus infection
    103013404 (CCND1)
   05165 Human papillomavirus infection
    103013404 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103013404 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103013404
NCBI-ProteinID: XP_007171185
UniProt: A0A383Z7I2
LinkDB
Position
Un
AA seq 214 aa
MNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQME
LVLVNKLKWNLAATTPHDFIEHFLSKMPVVEENKQIIRKHAQTFVALCATDVKFISNPPS
MVAAGSVVAAVQGLHLGSANSFLSYHRLTRFLSKVIRCDPDCLRACQEQIEALLESSLRQ
AQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVDI
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcagctg
ctgggggccacctgcatgttcgtcgcctcgaagatgaaggagaccatccccctgacggcc
gagaagctgtgcatctacactgacaactccatccggcccgaagagctgctgcaaatggag
ctggtcttggtgaacaaactcaagtggaacttggctgccacgaccccgcacgacttcatt
gaacacttcctctccaaaatgccggtggtcgaggagaacaaacagatcatccgcaaacac
gcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaacccgccctcc
atggtggctgccgggagcgtggtggccgcagtgcaaggcctgcacctgggaagcgccaac
agcttcctgtcctatcaccgcctgacgcggttcctctccaaggtgatccggtgtgacccg
gactgcctccgcgcctgccaggagcagatcgaagccctcctggagtccagcctgcgccag
gcccagcagcagaacttggaccccaaggccgcggaggaggaggaggaggaggaggaggtg
gacctggcctgcacgcccaccgacgtgcgtgacgtggacatttga

DBGET integrated database retrieval system